KEGG   Halorubrum lacusprofundi: Hlac_1808Help
Entry
Hlac_1808         CDS       T00856                                 

Definition
alcohol dehydrogenase GroES domain protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Hlac_1808
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_1808
  Lipid metabolism
   00071 Fatty acid degradation
    Hlac_1808
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hlac_1808
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hlac_1808
   00626 Naphthalene degradation
    Hlac_1808
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hlac_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1822976..1824049)
Genome map
AA seq 357 aa AA seqDB search
MRAAILREYGEPLDIHEVPDPEPGPDGAVVRVTACGVCRSDWHAWAGHGEWADDRVPRGQ
VLGHEPAGEVVTVGDSVDRFAPGDRVVVPFSLGDGTCPRCRQGHGNVCDDGRALGFEPEA
PGAFAERVAVPDADYNLVERPPWLDATAAAALGCRYMTAYHALAERAGLDGGEWLAVHGC
GGVGLSAVQLGDALGARIVAVDVDDDALSLARDLGADETVNPNDLDEETVPDRVRNLTDG
GADVSVDALGIAETCRNSVRSVRPRGTHVQVGLTTEAERGEVSLPTDWMTRWEVSFVGSR
GMPPTSYDDLFALVEATDVDPAALVSEELALSEVSERLAAMGEYDARGVEVVTDFGR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggcgatcctccgcgagtacggcgaaccgctggacatccacgaggttcccgac
ccggaacccggcccggacggcgccgtggtccgcgtgacggcctgtggcgtctgccggagc
gactggcacgcgtgggcgggccacggcgagtgggccgacgatcgcgtcccccgcggacag
gtgctcggccacgagcccgccggcgaagtggttaccgtcggcgactccgtcgaccggttc
gcgccgggcgaccgcgtcgtcgttccgttctcgctcggcgacggcacctgtccgcgctgt
cggcagggacacgggaacgtctgtgacgacgggcgagcgctcggcttcgagcccgaggcg
cccggcgcgttcgccgagcgcgtcgccgtcccggacgccgactacaacctcgtcgagcgc
ccgccgtggctcgacgcgaccgccgcggccgcgctcggctgccggtacatgaccgcgtat
cacgccctcgcggagcgggctggactcgacggcggcgagtggctggccgtccacggttgc
ggcggcgtcgggctctcggcagtccaactgggcgacgcgctcggggcacggatcgtcgcg
gtcgatgtcgacgacgacgccctctcgctcgctcgcgatttgggggccgacgagactgtg
aatccgaacgacctcgacgaggagacggttccggaccgggttcgaaacctcaccgacggc
ggggcggacgtttctgtggacgcgctcggtatcgccgagacgtgccgcaactcggtccgg
tccgttcgcccccgcgggacccacgtgcaggtgggactgaccacggaggcggagcgcggt
gaggtgtcgctgccgaccgactggatgactcgctgggaggtgtcgttcgtcggctcgcgc
gggatgcccccgaccagctacgacgacctgttcgcgctcgtcgaggcgaccgacgtggac
cccgccgcgctggtgagcgaggagctggcgctctcggaggtctcagaacggctcgccgcg
atgggcgagtacgatgcgcggggcgtcgaggtcgttacggactttgggagataa

DBGET integrated database retrieval system