KEGG   Halorubrum lacusprofundi: Hlac_1988Help
Entry
Hlac_1988         CDS       T00856                                 

Definition
succinate dehydrogenase, subunit D (membrane anchor protein)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hla  Halorubrum lacusprofundi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hlac_1988
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hlac_1988
   00650 Butanoate metabolism
    Hlac_1988
  Energy metabolism
   00190 Oxidative phosphorylation
    Hlac_1988
   00720 Carbon fixation pathways in prokaryotes
    Hlac_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1982980..1983354
Genome map
AA seq 124 aa AA seqDB search
MAERYSSFNSGGRMWLLQRVTAAFLLIVLAFHFFLLHFVHHADEVTLAASSARMEQLSYY
SLMVLFLVTATFHGVNGVYNALINQGLTGTKRTVVKWTLVAASVVLLFQGIRTANAWAGG
FPLL
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcgttactcctcgttcaactccggcggtcggatgtggctgctccagcgcgtc
acggcggcgttcctactgatcgtgctggcgttccacttcttcctgctccacttcgtccac
cacgcggacgaggtcacgctcgcggccagctcggcgcggatggagcagctgagctactac
tcgctaatggtgctgttcctcgtaacggcgacgttccacggggtcaacggcgtatacaac
gccctcatcaaccaggggctgaccggcaccaaacgcacggtcgtcaagtggacgctcgta
gccgcgagcgtcgtgctgctgttccaggggattcggacggcgaacgcgtgggcgggcggc
ttcccactgctctga

DBGET integrated database retrieval system