KEGG   Halorubrum lacusprofundi: Hlac_2117Help
Entry
Hlac_2117         CDS       T00856                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hla  Halorubrum lacusprofundi
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hlac_2117
Enzymes [BR:hla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hlac_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2107331..2108347)
Genome map
AA seq 338 aa AA seqDB search
MTDSPPVLAVGAAAIDEWYAVSNLPEPDGGAFASEVTTAFGGVGANVCVALDRLGREVGL
VSRVGDDEYGRRAFEYLADTGVDASRVSVGNDPSTRSVILSDPAGERTIVTTGESFRRLR
LNETDREALAAADIVFLTGYTPDAVSRAVLDTIESAADPPALVFDLSGSVEELVGRGTES
ETIHRYLHAADLFVADDVAAAAYFGGPDAAVDRVAAAQQAREANGRSPVTGDGWPRAVLT
HGADGMTVVADGAVTEFDAFDVDVVDATGAGDSFVAGLIDRWIAGSDSGDDPRRERAGVA
DGVRFAAAVAAINCTSRFAQTGLPTRDDVEAFLAERGF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactctcctccggtcctcgcagtcggcgccgcagcgatcgacgagtggtacgcc
gtcagcaacctccccgagccggacggcggcgcgttcgcgagcgaggtgacgaccgcgttc
ggcggcgtcggcgccaacgtctgcgtcgcgctcgatcgactcggacgcgaagtcggactc
gtgagccgcgtcggcgacgacgagtacggtcggcgggccttcgagtacctcgcggacacc
ggggtcgacgcctcgcgcgtctctgtcgggaacgacccctcgacgcggtcggtgatcctc
agcgatcccgcgggcgagcgcaccatcgtcactacgggcgagagcttccgacgcctccgg
ctgaacgagacggaccgtgaggcgctcgcggcggccgatatcgtcttcctcaccgggtac
acgcccgacgcggtctcgcgggcggtgctcgataccatcgagtcggccgccgatccgccc
gcactcgtcttcgacctctcgggttcggtcgaggaactcgtcggtcgcgggacggagtcg
gagacgatccaccggtacctccacgccgcggacctgttcgtcgccgacgacgtggcggcc
gcggcgtacttcggcggcccggacgcggcggtggaccgcgtcgcggccgcacagcaggcg
cgcgaggcgaacggtcggtccccggtgaccggcgacggctggccccgcgccgtcctgacc
cacggcgccgacgggatgacggtcgtcgctgacggcgcggtcaccgagttcgacgcgttc
gacgtcgacgtggtcgacgcgaccggggccggggactcgttcgtcgcggggctgatcgac
cggtggatcgccgggagcgacagtggtgacgacccacgccgcgagcgcgccggcgtcgcc
gacggcgtccggttcgcggccgcggtcgccgcgataaactgcacgtcccggttcgcccag
acggggcttccgactcgcgacgacgtggaggcgttcctcgcggagcgaggattctga

DBGET integrated database retrieval system