KEGG   Halorubrum lacusprofundi: Hlac_2167Help
Entry
Hlac_2167         CDS       T00856                                 

Definition
dihydrofolate reductase region (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hla  Halorubrum lacusprofundi
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hlac_2167
   00670 One carbon pool by folate
    Hlac_2167
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Hlac_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2156114..2156698
Genome map
AA seq 194 aa AA seqDB search
MAGDASAGGDADAADGTDIDLVLVAAVAENRVIGDDGGMPWHYPADLARFKRLTTGHPVI
VGRATYESIADRIGGPLPDRTSVVLTTRDLDLPEGAVVANDLDEAVDLAGADAADRGVDD
VYVIGGATVYEQFLDRADRMVLTEVPEQPDGDTRFPDWDDEEWVETEREVVGADGERGGE
ADALAFVTYERVDG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgacgcgtccgccggcggcgacgctgatgcggccgacggcaccgacatcgac
ctcgtcctcgtcgccgccgtcgccgagaaccgcgtcatcggcgacgacggagggatgccg
tggcactatccggccgatctggcgcgcttcaagcggctcacgaccggtcaccccgtgatc
gtcggccgcgcgacctacgagagcatcgccgaccggatcggcggcccgctccccgaccga
accagcgtcgtgttgacgacccgcgacctcgatctccccgagggcgccgtcgtcgcgaac
gacctcgacgaggcggtcgatctcgcgggcgccgacgccgccgaccgcggtgtcgacgac
gtgtacgtcatcggcggtgcgaccgtctacgagcagttcctcgaccgcgccgaccggatg
gtgctgacggaggtccccgagcagcccgacggcgacacgcgcttcccggactgggacgac
gaggagtgggtcgagacggagcgcgaggtggtcggagctgacggcgaacgcggcggcgag
gccgacgcgctcgcgttcgtcacctacgaacgggtcgacgggtga

DBGET integrated database retrieval system