KEGG   Halorubrum lacusprofundi: Hlac_2207Help
Entry
Hlac_2207         CDS       T00856                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hla  Halorubrum lacusprofundi
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hlac_2207
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hlac_2207
   00640 Propanoate metabolism
    Hlac_2207
   00660 C5-Branched dibasic acid metabolism
    Hlac_2207
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hlac_2207
Enzymes [BR:hla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hlac_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2190338..2191483
Genome map
AA seq 381 aa AA seqDB search
MKLHEHQAKTIFADAGIPVPDSRLATTVDEALDAVDEIGYPAAIKAQVHVGGRGKAGGIK
IATDRDEAEQYAEEILGMDLKGYTVDQILVEQGVDFVDELYVGVTMDRGEGQPVLMVSTE
GGVNIEEVAEENPDAIAREHVDPAFGLHPYQARKVVYEAGVDADVALDVASILTTLYDLY
EENDASEIEVNPVMITSDRDVIAADAVMNIDEDALFRHPDLAEMAEESYEDDLERKAGEY
GFDYVRLSGNVGIIGNGAGLVMTTLDLVDYYGGKPANFLDIGGGAKAERVTKALDMVFSD
ENVDAVVFNIFGGITRGDEVAKGINEALEQFDEIPKKVVVRLAGTNAEEGMEILNTDLVE
VEETLEDAVQRAVKNAEEVTQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacacgaacatcaagcgaagactatcttcgccgacgccgggatcccggtaccg
gactcccggctcgcgacgaccgtcgacgaggcgctcgacgcggtcgacgagatcggctac
ccggccgcgatcaaggcgcaggtccacgttggcggccgcggcaaggccggcgggatcaag
atcgcgaccgaccgcgacgaggccgagcagtacgccgaggagatcctcgggatggatctg
aaggggtacaccgtcgatcagatcctcgtcgaacagggcgtcgacttcgtcgacgaactg
tacgtcggcgtcacgatggaccggggcgagggacagccggttctgatggtctcgaccgag
ggcggcgtgaacatcgaggaggtcgccgaggagaaccccgacgcgatcgcgcgcgagcac
gtcgaccccgcgttcgggctccacccgtatcaggcccgcaaggtcgtctacgaggccggc
gtcgacgccgacgtggcgctggacgtggcctcgatcctcacgacgctgtacgacctctac
gaggagaacgacgcctcggagattgaggtcaaccccgtgatgatcacgagcgaccgcgac
gtgatcgccgcggacgccgtgatgaacatcgacgaggacgcgctgttccgccaccccgac
ctcgccgagatggccgaggagtcctacgaggacgacttagagcggaaggccggcgagtac
ggcttcgactacgtccgcctctccgggaacgtcggcatcatcggcaacggcgccgggctc
gtgatgacgaccctcgatctggtcgactactacggcggcaagcccgccaacttcctcgac
atcggcggcggcgcgaaggccgagcgcgtcacgaaggcgctcgacatggtcttctccgac
gagaacgtcgatgccgtcgtgttcaacatcttcggcgggatcactcgcggcgacgaggtc
gccaaggggatcaacgaggccctagagcagttcgacgagattcccaagaaggtggtcgtc
cggctcgccggcacgaacgccgaggaggggatggagatcctgaacacggatctcgtggaa
gtcgaggagacgcttgaggacgcggtccagcgcgcggtgaagaacgcagaggaggtgacc
caatga

DBGET integrated database retrieval system