KEGG   Halorubrum lacusprofundi: Hlac_2234Help
Entry
Hlac_2234         CDS       T00856                                 

Definition
(GenBank) peptidase M42 family protein
Organism
hla  Halorubrum lacusprofundi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2219556..2220620
Genome map
AA seq 354 aa AA seqDB search
MRDSQRAFLNDLLATASPSGFETPSQRVWTDYVRGFADEVSVDAYGNAVAVHEGDPDAPT
IALTGHADEIGFIVRDVLDDGFLRISRIGGSDRTVSKGQHVTVHADEPVQGVIGQTAIHL
RDRSEDEYEKIAEQFVDIGAADAEEARECVEIGDPVTFSTEVEELVGDRIAARGIDNRTG
TWAAAEGLRRATERDIDATVYAISTVQEEVGLQGAQMVGVDLETVDAFVAVDVTHATDNP
DVDGEHRGPVELGSGPVIARGSANHPVLVDLARDAAAAADIDVQLQAAGTRTGTDADAFY
TVQGGVPSLNVSIPNRYMHTPVEVVDIADLDAVADLLAAIADGAGDATPFAVDV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgactcacagcgagcgttcctcaacgacctactcgccaccgctagcccctccggc
ttcgagacgccgagccagcgagtctggaccgactacgttcgcggcttcgccgacgaggtc
tccgtcgacgcctacggcaacgccgtcgccgttcacgagggcgaccccgacgcgcccacc
atcgccctgaccggccacgccgacgagatcggattcatcgtccgcgacgtgctcgacgac
ggtttcctgcggatctcccggatcggcggctccgaccgcaccgtctcgaagggccagcac
gtcaccgtccacgccgacgagccggtgcagggcgtgatcggtcagaccgcgatccacctg
cgggaccgctcggaagacgagtacgagaagatcgccgagcagttcgtcgacatcggcgcg
gctgacgccgaagaggcgcgcgagtgcgtcgagatcggcgatcccgtcacattctcgacc
gaggtggaagagctggttggcgaccggatcgccgcccgcggtatcgacaaccggaccggc
acgtgggcagccgcggaagggctccgccgcgcgaccgagcgtgacatcgacgccaccgtc
tacgccatttccacggtacaggaggaggtcgggctccagggcgcccagatggtcggcgtc
gacctcgagacggtggacgcgttcgtcgccgtcgacgtcactcacgccaccgataacccc
gatgtcgacggagaacaccgaggcccggtcgagctcggctccggacccgtgatcgcccgt
ggcagcgcgaaccaccccgtcctcgtcgacctcgcgcgcgacgccgcggccgctgccgac
atcgacgtacagctacaggcggccggcacgcgaactggtaccgacgccgacgccttctac
accgttcagggcggtgtcccgtcgctcaacgtctcgatcccgaaccgctacatgcacacc
ccggtcgaagtggtcgacatcgccgacctcgatgccgtcgccgatctcctcgccgcgatc
gccgacggcgcgggcgacgccacgcccttcgccgtcgacgtgtga

DBGET integrated database retrieval system