KEGG   Halorubrum lacusprofundi: Hlac_2256Help
Entry
Hlac_2256         CDS       T00856                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hlac_2256
   00030 Pentose phosphate pathway
    Hlac_2256
   00051 Fructose and mannose metabolism
    Hlac_2256
   00052 Galactose metabolism
    Hlac_2256
   00500 Starch and sucrose metabolism
    Hlac_2256
   00520 Amino sugar and nucleotide sugar metabolism
    Hlac_2256
  Nucleotide metabolism
   00230 Purine metabolism
    Hlac_2256
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hlac_2256
Enzymes [BR:hla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hlac_2256
    5.4.2.8  phosphomannomutase
     Hlac_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2244256..2245617)
Genome map
AA seq 453 aa AA seqDB search
MELFGSSGIRGVALRYLTPELVLGIAKAAGTTWDADRVAVARDTRTTGELFANAAASGLA
AVGCDVDRLGVVPTPAVGNYCESAGIPCVLVTASHNPPEFNGIKLVGDDGVELSVDVLER
VERRVLDDEYDHADWRNAGATTRVECAVDDYVDQLLDAVDREAIADANLTVAVDPGHGAA
SVSSPRIYRELGCEVLTVNATPDGHFPGRDSEPVPENLDDLQRLVATTDADVGIAHDGDA
DRAVFVDENGEFVDGDTSFAVMADACLEPGDAVVSAVNVSQRLVDVCNANDADLELTPIG
ATNIITRTRDLHDEGTNVPIAGEGNGGVFFPPYRLSRDGAYIGARFLELLAAASDPVSEV
VAPYADYHFVRRNVEYADDDERDEMLSAARAYVETADAEPNTTDGYRLDYGDAWVLVRPS
GTEPKIRIYAESADADRAERLATDMYVAVESGR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttcggatctagcggcattcgcggggtcgcgctccggtatctcacgccggaa
ctcgtcctcggaatcgcgaaggccgccggcacgacctgggacgccgaccgggtcgccgtc
gcccgcgacacccgtaccaccggcgagctgttcgccaacgccgctgcgagcgggctggcc
gcggtcggctgcgacgtcgaccggctcggcgtcgtcccgacgccagcggtcggcaactac
tgcgagtcggccggcattccctgtgtcctcgtcacggcctcgcacaacccgccggagttc
aacgggatcaagctcgtcggcgacgacggcgtggagctgtcggtcgacgtgctcgaacgc
gtcgaacgtcgcgtcctcgacgacgagtacgaccacgccgactggcggaacgcgggcgct
acaacccgcgtcgagtgcgccgtcgacgactacgtcgaccagctgctcgacgcggtcgac
cgcgaggcgatcgccgacgcgaacctcacggtcgcggtcgaccccggccacggcgcggcg
tcagtgtcgtcgccgcggatctaccgagagctcggctgtgaggtgctgaccgtgaacgcg
acaccggacggtcacttccccggccgggattcggagccggtcccggagaacctcgacgac
cttcaacggctcgtcgcgaccaccgacgccgacgtggggatcgcccacgacggcgacgcg
gaccgagcggtgttcgtcgacgagaacggggagttcgtcgacggtgacacctcgttcgca
gtgatggcagacgcctgcctcgaacccggtgatgccgtcgtcagcgcggtgaacgtctcc
cagcggctcgtcgatgtctgcaacgccaacgatgctgacttggagctgacccccatcgga
gcgacgaacatcatcacgcgaacgcgcgacctccacgacgaggggacgaacgtccccatc
gccggcgaagggaacggcggggtgttcttcccgccgtatcggctctcgcgcgacggtgcg
tacatcggcgcgcgcttccttgagctgctcgcggccgccagcgacccggtcagcgaggtg
gttgccccctacgccgactaccacttcgtgcggcgcaacgtcgagtacgcggacgacgac
gagcgcgacgagatgctgtcagccgcgcgagcttacgttgagaccgcggacgcggagccg
aacaccaccgacggctaccgtctcgactacggggacgcgtgggtgctcgtgcgcccctcc
ggcaccgaaccgaagatccggatctacgccgagtccgccgacgccgaccgcgccgagcgg
ctggcgacagacatgtacgtcgcagtcgagagcggacggtag

DBGET integrated database retrieval system