KEGG   Halorubrum lacusprofundi: Hlac_2268Help
Entry
Hlac_2268         CDS       T00856                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hla  Halorubrum lacusprofundi
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Hlac_2268
Enzymes [BR:hla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Hlac_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2255955..2256644
Genome map
AA seq 229 aa AA seqDB search
MSREDPDFDANANPDLLRDARGAVVEYAPALADLTPGRTGNLSVREGDAVAVTPTGVPYD
SFDATDVPVVSLEGERLAGRMAPSSEVPMHTGIYKHDRPGAIVHTHSPWATTMATLHRKL
PPVHYMIAAVGREVPLADYAPYGTEELAANVVAAMAEADSDAAILANHGLVVTGPDIETA
VENTHHVEDLCRLYLRASAVGEPHVLSDEQMATVEERFESYGQQPNDDS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagccgagaggatcccgattttgacgccaacgccaatcccgacctcctgcgcgacgcc
cgcggggcggtcgtggagtacgcaccggcgctcgcggacctgacgcccgggcggaccggg
aacctgagcgtccgcgagggcgacgcggtcgcggtgacgccgactggagtcccgtacgac
tccttcgacgcgaccgacgtgccggtggtctcgctggagggcgagcgcctggcgggccgg
atggccccgtcgagcgaggtgccgatgcacacgggcatttataagcacgaccgaccgggc
gcgatcgttcacacccactcgccgtgggcgacgacgatggcgacgctccaccggaagctc
ccgcccgttcactacatgatcgcggccgtggggcgggaggttccgctggccgactacgcg
ccatacggcaccgaagagctggccgcgaacgtggtggctgcgatggccgaggccgactcc
gacgccgcgatcctcgcaaaccacgggctcgtcgtcaccgggccggacatcgagacggcg
gtcgagaacacccaccacgtcgaggacctctgccggctctacctccgggcgtcggcggtc
ggcgagccgcacgtgctctccgacgagcagatggcgaccgtcgaggagcggttcgagagc
tacggccagcagccgaacgacgactcgtag

DBGET integrated database retrieval system