KEGG   Halorubrum lacusprofundi: Hlac_2478Help
Entry
Hlac_2478         CDS       T00856                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hla  Halorubrum lacusprofundi
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hla01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hla00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2455413..2456690
Genome map
AA seq 425 aa AA seqDB search
MDVRTVADLSPAERLAFFERDAGVDAVRDDVSEIVDRVRTEGDVALREFSEEFDGVAVGN
IDITDDAERAHAEFDDANDPVLDAVRDAAANIREFHERQHPEDWRDEFGDRELGRRFRPI
DRAGVYVPGGAAAYPSSALMGVIPAAVAGVDHVSVATPPAEEINPVTLAAIHEAGADAVY
QVGGAQAIAALAYGTETVTNAQKVVGPGNKWVTAAKAIVQGDVEIDFLAGPSEVLVLADE
TADPDLVASDLIAQAEHDPNASVVAVTDDAALAEAVAEAVDEQVAGRKREETIRAALDND
ASGVLHARSMPEAVLFTEEYAAEHLSIAADDDEALLARISNAGSVFLGAYSPVAAGDYAT
GTNHVLPTNGGAKRYGGLSVDTFLRSSTVQRLDRDALDGLSETITTLAEAEGLEAHAESV
RKRFE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacgaaccgtcgctgacctctcgccggccgagcgcctcgccttcttcgagcgc
gacgccggcgtcgacgcggtccgcgacgacgtgagcgagatcgtcgatcgagtccggacg
gagggcgacgtcgcgctccgagagttctccgaggagttcgacggcgtggccgtcggcaac
atcgacatcaccgacgacgccgagcgcgcccacgccgaattcgacgacgcaaacgatccg
gtcctcgacgcggtccgcgacgcggccgccaacatccgcgagttccacgagcgacagcac
cccgaggactggcgcgatgagttcggcgaccgcgaactcggccgccggttccgcccgatc
gaccgcgccggggtgtacgtgcccggcggcgcggcggcgtacccctccagcgcactgatg
ggcgtgatcccggcggcagtggcgggcgtcgaccacgtctcggtcgcgacgccgccggcc
gaggagatcaaccccgtcacgctcgcggcgatccacgaggccggcgccgacgcggtgtat
caggtcggcggcgcgcaggcgatcgccgcgctcgcgtacggcacggagaccgtcacgaac
gcccagaaggtggtcgggcccggcaataagtgggtcaccgccgcgaaggcgatcgtgcag
ggcgacgtggagatcgacttcctcgccgggccgagcgaggtgctcgtcctcgccgacgag
accgccgaccccgacctcgtcgcgagcgacctgatcgcgcaggccgaacacgacccgaac
gcctccgtggtcgccgtcaccgacgacgccgccctcgccgaggcggtcgcagaggcggtc
gacgagcaggtcgcgggccgtaaacgcgaggagacgatacgagccgccctcgacaacgac
gcctccggggtccttcacgccagatcgatgcccgaggcggtgttgttcaccgaggagtac
gcggccgaacacctctcgatcgcggccgacgacgacgaggcgctgctcgcccggatctcg
aacgctggctcggtgttcctcggggcgtactcccccgtcgccgccggcgactacgcaacc
gggacgaaccacgtgctgccgacgaacggcggcgcaaagcgctacggcgggctctccgtc
gacaccttcctccggtcgtcgacggttcagcgactcgaccgcgacgcgctcgacgggctc
tcagagacgatcacgacgctcgcggaggccgaggggctggaggcgcacgccgagagcgtt
cggaagaggttcgagtag

DBGET integrated database retrieval system