KEGG   Halorubrum lacusprofundi: Hlac_2719Help
Entry
Hlac_2719         CDS       T00856                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hlac_2719
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_2719
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hlac_2719
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hlac_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2707937..2709220
Genome map
AA seq 427 aa AA seqDB search
MDLAIDAPTPAAPDCADDGTWLACIECDETFAPFEAVRYTCDECDGLLEVRYDDPPTFDD
FGSGAASEGPDRGVWRYREALPFDLGVTLPEGGTPLHTVPRIEEAVGVETLRVKHEGMNP
TGSFKDRGMTVGVRVAEELGVGALACASTGNTSAALAAYGGRGGMETLVLLPKGKVAAGK
IAQASLHGARILEVDGNFDACLDIVQELAARGEAYLLNSLNPFRLEGQKTIGFEILEEFR
DDYGTFPDRIVLPVGNAGNTSALYKAFRELVQSGALDVDEVPKLTGVQAEGAAPMVEAIE
EGNDEVRRWEEVETRATAIRIGNPVNAPKALPGIRNTGGTAVAVSDDEITDAQRDLAEEG
VGVEPASAASLAGLRKLRREGVVEDDEQVVCLTTGHLLKDPDAAYEAGSDPEPVPNDVDA
VVEHLRD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgccatcgacgccccgactccggcggcgcccgactgcgccgacgacgggacg
tggctcgcctgcatcgagtgcgacgagacgttcgcccccttcgaggcagtccggtacacc
tgcgacgagtgtgacggtctgctcgaagtacgctatgacgacccgccgacgttcgacgac
ttcggctcgggcgccgcctccgagggccccgatcgcggcgtctggcgctaccgcgaggcg
ctcccgttcgatctgggcgtgacgctccccgagggcggcaccccgctgcacaccgttccc
cgaatcgaggaggcggtcggcgtcgagacgctccgggtcaaacacgaggggatgaacccc
accggctcgttcaaggaccgcgggatgaccgtcggcgtccgagtcgccgaggaacttggc
gtcggcgcgctcgcctgtgcgtccaccgggaacacctccgccgcgctggcggcgtacggc
ggccgcggcgggatggaaacgctcgtgctccttccgaaggggaaggtcgccgccgggaag
atcgcgcaggcgagtctccacggcgcccgcatcctcgaagtcgacggcaacttcgacgcc
tgtctcgacatcgtccaagaactggccgcccgcggcgaggcgtacctgctcaactcactg
aacccgttccgcttagagggccagaagacgatcggcttcgagatattagaggagttccga
gacgactacgggaccttcccggaccggatcgtcctccccgtcggcaacgcgggtaacacc
tcggcgctgtacaaggcgtttcgcgagctggtccagtcgggcgcgctcgacgtcgacgag
gtccccaaactgaccggcgtgcaggccgaaggcgccgccccgatggtcgaggcgatcgag
gagggcaacgacgaggttcggcgctgggaagaggtcgagacgcgcgcgaccgcgatccgc
atcgggaacccggtcaacgccccgaaggcgctcccggggatccggaacaccggcggcacg
gcggtcgccgtcagcgacgacgagatcaccgacgcgcagcgcgacctcgccgaggagggc
gtcggcgtcgaacccgcctccgccgcgagcctcgccggactcaggaagctccgccgcgag
ggcgtcgtcgaggacgacgagcaggtcgtctgcctgacgacggggcaccttttaaaagac
cccgacgccgcctacgaggccgggagcgaccccgaacccgtcccgaacgacgtggacgcg
gtcgtcgagcacctgcgcgactga

DBGET integrated database retrieval system