KEGG   Halorubrum lacusprofundi: Hlac_2719Help
Entry
Hlac_2719         CDS       T00856                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
hla00260  Glycine, serine and threonine metabolism
hla00750  Vitamin B6 metabolism
hla01100  Metabolic pathways
hla01110  Biosynthesis of secondary metabolites
hla01120  Microbial metabolism in diverse environments
hla01230  Biosynthesis of amino acids
Module
hla_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hlac_2719
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hlac_2719
Enzymes [BR:hla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hlac_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP C1_2
Motif
Other DBs
NCBI-ProteinID: ACM58290
JGI: Hlac2719
UniProt: B9LUM3
Position
1:2707937..2709220
Genome map
AA seq 427 aa AA seqDB search
MDLAIDAPTPAAPDCADDGTWLACIECDETFAPFEAVRYTCDECDGLLEVRYDDPPTFDD
FGSGAASEGPDRGVWRYREALPFDLGVTLPEGGTPLHTVPRIEEAVGVETLRVKHEGMNP
TGSFKDRGMTVGVRVAEELGVGALACASTGNTSAALAAYGGRGGMETLVLLPKGKVAAGK
IAQASLHGARILEVDGNFDACLDIVQELAARGEAYLLNSLNPFRLEGQKTIGFEILEEFR
DDYGTFPDRIVLPVGNAGNTSALYKAFRELVQSGALDVDEVPKLTGVQAEGAAPMVEAIE
EGNDEVRRWEEVETRATAIRIGNPVNAPKALPGIRNTGGTAVAVSDDEITDAQRDLAEEG
VGVEPASAASLAGLRKLRREGVVEDDEQVVCLTTGHLLKDPDAAYEAGSDPEPVPNDVDA
VVEHLRD
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgccatcgacgccccgactccggcggcgcccgactgcgccgacgacgggacg
tggctcgcctgcatcgagtgcgacgagacgttcgcccccttcgaggcagtccggtacacc
tgcgacgagtgtgacggtctgctcgaagtacgctatgacgacccgccgacgttcgacgac
ttcggctcgggcgccgcctccgagggccccgatcgcggcgtctggcgctaccgcgaggcg
ctcccgttcgatctgggcgtgacgctccccgagggcggcaccccgctgcacaccgttccc
cgaatcgaggaggcggtcggcgtcgagacgctccgggtcaaacacgaggggatgaacccc
accggctcgttcaaggaccgcgggatgaccgtcggcgtccgagtcgccgaggaacttggc
gtcggcgcgctcgcctgtgcgtccaccgggaacacctccgccgcgctggcggcgtacggc
ggccgcggcgggatggaaacgctcgtgctccttccgaaggggaaggtcgccgccgggaag
atcgcgcaggcgagtctccacggcgcccgcatcctcgaagtcgacggcaacttcgacgcc
tgtctcgacatcgtccaagaactggccgcccgcggcgaggcgtacctgctcaactcactg
aacccgttccgcttagagggccagaagacgatcggcttcgagatattagaggagttccga
gacgactacgggaccttcccggaccggatcgtcctccccgtcggcaacgcgggtaacacc
tcggcgctgtacaaggcgtttcgcgagctggtccagtcgggcgcgctcgacgtcgacgag
gtccccaaactgaccggcgtgcaggccgaaggcgccgccccgatggtcgaggcgatcgag
gagggcaacgacgaggttcggcgctgggaagaggtcgagacgcgcgcgaccgcgatccgc
atcgggaacccggtcaacgccccgaaggcgctcccggggatccggaacaccggcggcacg
gcggtcgccgtcagcgacgacgagatcaccgacgcgcagcgcgacctcgccgaggagggc
gtcggcgtcgaacccgcctccgccgcgagcctcgccggactcaggaagctccgccgcgag
ggcgtcgtcgaggacgacgagcaggtcgtctgcctgacgacggggcaccttttaaaagac
cccgacgccgcctacgaggccgggagcgaccccgaacccgtcccgaacgacgtggacgcg
gtcgtcgagcacctgcgcgactga

DBGET integrated database retrieval system