KEGG   Halorubrum lacusprofundi: Hlac_2868Help
Entry
Hlac_2868         CDS       T00856                                 

Definition
Glycoside hydrolase family 42 domain protein (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
hla  Halorubrum lacusprofundi
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Hlac_2868
Enzymes [BR:hla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Hlac_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(127597..129699)
Genome map
AA seq 700 aa AA seqDB search
MRLGVCYFPEHWPSEEWERDVAAMADAGLEYVRMAEFSWGVLEPERGTFDFEWLDEAIEL
IGDHGMQAVLCTPTATPPKWLVDERPSIRQEDPDGTVREHGSRRHYCFNSDAYREETARI
VERVTERYADSPHVAGWQTDNEFGCHETVRCYCDDCADAFRTWLADRYGDIDRLNEAWGN
AFWSQQYGSFDEIDPPGPTPAEHHPSRLLAYARFSSDSVVEYNRLHADLIREADPDWFVT
HNFMGRFPTLNAYDVSEDLDRVAWDSYPTGFVQDRYDGEASPDQLRAGDPDQVGMDHDIY
RSALDRPFWVMEQQPGDVNWPPHCPQPGEGAMRLWAHHAAAHGADAVLYFRWRRCLEGQE
QYHAGLRKADGSPDRGYADAAHTSEEFATLDGASHVDAPVAVVFDYDSLWALNAQPHAPD
FDYWALQEAFYGAVRGRGVQVDVVPPSADLSGYAAVVAPALHLVTEDLADRLTDYIAGGG
EVLFGPRTGVKDAENKLRPMSQPGPLTDLVGATVDQHESLPRRLETTVRRVGDPTDDSEE
IAAPPVSFRTWAEWLDPDAAEPQYAYDVDGPADGRPAVVTNTVGDGQVTYCGVWPESDLA
DALASDLLDRAGVRYAERLPDGVRIGYRGGRTWVTNFTSDRLRLPEIDPESLAVDDTDRD
GFDPMADDDKDSSADGIVVGPYGVAVIEGDCVDGLRIAQT
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcggagtctgttactttcccgaacattggccgagcgaagagtgggaacgcgat
gtcgctgcgatggccgacgccggcctcgaatacgtgcggatggcggagttctcgtgggga
gtcctcgagcccgagcggggtacattcgatttcgagtggcttgatgaggccatcgagctc
atcggcgaccacggcatgcaggcggtgttgtgcacgccgacggcgacgccgccgaagtgg
ctggtcgacgagcggccgtcgatccggcaagaagaccccgacggaaccgtccgcgaacac
ggcagccgccggcactactgtttcaactccgacgcctaccgcgaggagacagctcggatc
gtcgagcgggtcaccgagcgatacgccgactcgccgcacgtcgccggctggcagacggac
aacgagttcggctgtcacgagaccgtccggtgttactgcgacgattgtgccgacgcgttc
cgaacgtggctcgcggaccggtacggtgatattgaccgactcaacgaggcgtgggggaac
gcgttctggagccagcagtacggctccttcgacgaaatcgatccgcctgggccgacccct
gcagagcatcacccctcgcggctgctggcgtacgcacgcttttccagcgattccgtcgtc
gagtacaatcgcctccacgccgacctgatacgcgaggctgaccccgactggttcgtcacc
cacaatttcatggggcggttcccgacgctgaacgcctacgacgtgagcgaggacctcgac
cgcgtcgcctgggactcatacccgacggggttcgtccaggaccgatacgacggggaggca
tccccggaccagctgcgagccggcgaccccgaccaggtcgggatggatcacgacatctac
cggagcgcgctcgaccggccgttctgggtgatggaacaacaaccgggcgatgtaaactgg
ccgccgcactgtccgcagccgggtgagggtgctatgcgtctgtgggcgcaccacgccgcc
gcccacggagccgacgcagtcctctacttcaggtggcggcgctgtctcgagggtcaagaa
cagtatcacgccggactccggaaggccgacgggtcgcccgaccgcggatacgccgacgcc
gcacacacgtccgaggagttcgcgactctcgacggggccagtcacgtggacgccccggtg
gcggttgtgttcgactatgactcgctctgggcgctcaacgcgcagccgcacgccccggac
ttcgactactgggcgctccaagaggcattctacggcgctgtacgcggccgtggcgttcag
gtcgatgtggttccgccaagtgccgatctctccggatacgcggccgtcgtcgcgcccgca
ctccacctcgttaccgaggatctcgccgaccggctgaccgactacatcgccggcggcggg
gaggttctcttcggtccccggaccggcgtgaaggacgcagaaaacaagctccggccgatg
tcccagcccggcccgctgaccgacctcgtcggcgcgaccgtcgatcagcacgagtcgctg
ccgcggcgcctcgaaacgacagtccgacgagttggtgaccccaccgacgactccgaggag
atcgcggcgccgcccgtctcgttccgaacctgggcggagtggctggaccccgatgcagcc
gagcctcagtacgcgtacgatgtcgacgggccggcggacggtcggccggcagtcgttacc
aacacagtcggtgacgggcaagtcacttactgtggagtctggcccgagtctgacctagcg
gacgcgcttgcgtcagacctgctcgaccgcgcgggcgtccgatacgccgagcggctccca
gacggtgtccggatcgggtaccgcggcggccgcacgtgggtgacgaacttcacgagcgac
cggctccggttgcccgaaatcgatcccgagtcgctggcggttgacgacactgatcgggac
ggtttcgacccgatggcggacgacgacaaggactcgtctgcagacggtattgttgtgggg
ccgtacggggtcgccgtcatcgagggtgactgcgtggacgggctgagaatcgctcagacg
tag

DBGET integrated database retrieval system