KEGG   Halorubrum lacusprofundi: Hlac_2869Help
Entry
Hlac_2869         CDS       T00856                                 

Definition
Alpha-galactosidase-like protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
hla  Halorubrum lacusprofundi
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Hlac_2869
  Lipid metabolism
   00561 Glycerolipid metabolism
    Hlac_2869
   00600 Sphingolipid metabolism
    Hlac_2869
Enzymes [BR:hla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Hlac_2869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:129829..131868
Genome map
AA seq 679 aa AA seqDB search
MNEHRVGATAVTHDPDGHAVTVGDDAGDLLVGTVHAATADGDDGRLQVADVSLSTEARGV
VATYTVENVGDEPVRAGDVTLAFETAFGADARVYRHGYQSWSSTGTLPVGERFSPENSDN
APMMNDLAASTDDRVSSYLTGLVEGDRRVTAGFLEHDRYCSRFEIDDDDGGVATLHAVCP
LEGARLTPGERLTLPPLWVDADRELREGLTALADCIGERMDARVPEISPTGWCSWYHYFT
DVTEADVRENLSELREWGIPVDVVQIDDGYMQAFGDWRSIANGFEDMSAVADDIAASGYR
PGLWLAPFYVEAGADLYADHPEWFITEPTDADTDGPGTPVDGGFRAGSELYGLDTTHPAV
LEWLRETVSTVVDDWGFTYLKLDFLFAAALPGERYDAEATRIEAYRRGVEAIAEAAGDDV
FLLGCGAPMAPSVGLFDAMRVGPDTDPVWETPGESGSQPGLKNAVRNTLTRNYLHRRWWL
NDPDCQLVRDTSDLTAAEREAFATLVAATGGVNIFSDRLAEIGSAGRRLLERSIPPASGG
EVSGLSVERFPSHVVCDRPGDGATTVALFNWADEPSTVRFDAREHVEGDSDADHVIWDGL
SGAVVDGPVVERELPSHGAAVFAVVPATTGNLLGDAATLTGGSDRASTATLRDGALEAAV
DGEAVTFALERDGPTSTQE
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacacagggtgggcgctactgcagtcacccacgatccggatggccatgcggtc
acggtcggagacgacgccggtgacctacttgtcgggacggtccacgcggcgacggccgac
ggagacgacgggcggctacaggtcgctgacgtgtcgctgtcgaccgaggcgagaggtgtc
gtcgcgacctacaccgtggaaaacgtcggcgacgagccggtccgggcaggcgacgtgaca
ctcgcgttcgagaccgcgttcggcgccgatgcccgcgtctaccggcacgggtatcaatcg
tggtcgtcgacgggaacgctccccgtcggagagcgattctcacccgagaactcggataac
gctccgatgatgaatgacctcgcggcgtcgacggacgaccgggtcagcagctatctgacc
gggcttgtcgagggcgaccgacgcgtcactgcgggctttctcgaacatgaccgctactgt
tctcgattcgagatcgatgacgacgatggcggcgttgcgacgctgcacgcagtgtgtcca
ctggaaggggcacggctgacacccggtgaacggctgactctgccaccactgtgggtcgac
gctgaccgcgaacttcgagaggggctgaccgcgctggccgattgcatcggtgagcggatg
gatgctcgcgtgcctgaaatctcaccgaccggatggtgctcgtggtatcactatttcacc
gatgtcaccgaggcggacgtgcgggagaacctctcggagcttcgagagtggggaattccg
gtcgacgtcgttcagatcgacgacggatacatgcaggcgttcggcgactggcggtcgatc
gccaacgggttcgaggacatgagcgccgtcgcggacgacatcgcggcttcggggtaccga
cccgggctgtggctcgcgccgttctacgtcgaggcgggtgccgacctatacgctgaccac
ccggagtggttcatcacggagccgacggacgcagacaccgacggcccgggaacacccgtc
gacggtggcttccgagccgggtcagaactatacggactcgacacgacgcacccggcggtg
cttgagtggctccgggagaccgtgtcgacggttgtcgacgactgggggttcacgtatctg
aagctcgacttcctctttgcggcggcgctgcccggcgagcggtacgacgccgaggcaacc
cggatcgaggcgtatcgccggggggtcgaggcgatagcggaggcggccggcgacgatgtg
ttccttctcggctgcggtgcgccgatggccccgagtgtcgggctcttcgacgcgatgcgg
gtcggcccagacaccgatccggtctgggagactccgggagagtcggggagccagccggga
ttgaaaaacgccgttcgcaacacgctcacacggaactacctgcatcgacggtggtggctc
aacgatcccgactgccaacttgttcgagacacgagtgacctcactgcggccgagcgcgaa
gccttcgcgacgctcgtcgccgcgacgggtggcgtgaacatattttcggaccggctcgcg
gagatcggttcggccggccggcggctgcttgagcggtccatccctcctgcaagcggcggc
gaggtctccgggctcagtgtggagcggttcccctcgcacgtcgtctgcgaccggccgggc
gacggggccacgaccgtcgcgctgtttaattgggcggacgagccgtcgacggtccgattc
gacgcgcgcgagcacgtggagggcgactcagatgccgatcacgtcatctgggacgggctg
tccggtgcggtcgtcgacgggccggtcgtcgagcgagagctaccctctcacggtgcggcg
gtgtttgctgtcgttcccgccaccaccggcaacctcctgggcgacgccgcgacgctcacg
ggtgggtccgaccgcgcgtcgacggcgacgcttcgggacggagcactcgaagcagccgtc
gacggggaggcggtgacgttcgcgctcgagcgggacggtcccacgtctactcaggagtag

DBGET integrated database retrieval system