KEGG   Halorubrum lacusprofundi: Hlac_3462Help
Entry
Hlac_3462         CDS       T00856                                 

Definition
magnesium chelatase ChlI subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hla  Halorubrum lacusprofundi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hla00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hlac_3462
Enzymes [BR:hla01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Hlac_3462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pHLAC01:211681..213945
Genome map
AA seq 754 aa AA seqDB search
MVDFGSHKKPSHAGRQRPRFDDVVGQHALKEALLAVATDDDLDGLLVQGEKGTAKSTTVQ
GLADLLPDQRVVADCDFGCHPEDASLQCVDCRDRENPPTAMRPVPLVTLPLGATRERIVG
TLSVADALDGDHEFDPGLLARAHRGVLYVDEVNLLDDHLVDVLLSAAASGVNRVERDGIS
VTHPAEFTLVGTMNPEEGDLRPQLRDRFALQTTVTGCSDLDDRVEIIDQALDEATETPDS
TSTGRDSGERLRDARDRIGDVVLERSLREDIAELCRDAGVDGHRGDIATARTARALAALD
GRDRVEENDVETAARFALPHRLRAQPFEDAPDVEEVVDEHFDDEGGAEDGESDAEDGEGD
AEDGERRAENGDDESGDADAGDAGGDDERDASGTGDREGGAGDAGDGALDDEGKAGDATA
AGDDESADDTEGDSDRPADEGDDEPRDASPRPSPGRGARSDDDSSANEQPRANPEGDAAE
GGTPLLPGQDRADVGEAAAPELSPPEAIAEPGSGTGSRASASPSVDANGSRVRTERTDAG
TGGVSVDAAASVRAASARGASSVESRDLRQSVRAGDSSALVLFVVDASASMRPAMRAAKG
TVLELLEDAYQHRDAVGFVAFAGTDAEVLLPPTDSVTLAARHLKSLPTGDRTPLPAGLRT
AGRVLDRADPAASVVVVVTDGRANVADGSPVAETRAAGRGLAERDAHVVVVAAGEDDGPT
VTDALVEASGGERVPLAALSAARVDESVREVRDQ
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggttgatttcggtagtcacaaaaaaccctcgcacgccggccgccagcggccgaggttc
gacgacgtcgtcggccagcacgccctcaaggaggcgttgctggcggtcgcgaccgacgac
gacctcgacggcctcctcgtgcagggcgagaagggaacggcgaagtccaccaccgtccag
gggctcgccgacctcctccccgaccagcgcgtcgtcgccgactgcgacttcggctgtcac
ccggaggacgcctcgctccagtgcgtcgactgtcgcgaccgtgagaacccgccgacagcg
atgcgaccagtgccgctcgtcacgctcccgctcggtgcgacgagagaacggatcgtcggc
acgctgtccgtcgcggacgcactcgacggcgaccacgagttcgaccccggcctgctcgca
cgcgcccaccgcggggtcctctacgtcgacgaggtgaacctgctcgacgaccacctcgtc
gacgtcctgctctccgccgccgccagcggcgtcaatcgcgtcgagcgcgacggcatcagc
gtcacgcaccccgcggagttcacgctcgtcgggacgatgaaccccgaagaaggcgacctc
cggccccagctccgcgaccggttcgcgctccagacgacggtcacgggctgttcggacctc
gacgaccgcgtcgagatcatcgaccaggcgctggacgaggccaccgaaaccccggattcg
acgtccaccggacgcgactccggcgagcgcctgcgcgatgccagggaccgcatcggcgac
gtcgtactcgaacgctccctccgcgaggacatcgcggaactctgccgggacgccggcgtc
gacggtcatcgcggcgacatcgcgacagcgcggaccgcacgagcgctcgccgcactcgac
ggccgcgaccgcgtcgaggagaacgacgtcgagaccgcggcacgcttcgcgctcccgcat
cgactccgggcacaaccgttcgaggacgcccccgacgtagaggaggtcgtcgacgaacac
ttcgacgacgaaggtggcgcagaggacggcgagagcgacgccgaggacggcgagggtgac
gccgaagacggcgaacgccgggccgagaacggagatgacgagtccggtgacgccgatgcc
ggcgacgctggtggggacgacgaacgcgacgcctccggcacaggggacagggaaggaggc
gctggtgatgccggcgatggggctctcgacgacgaggggaaggccggggacgcgaccgcc
gcaggcgacgacgaatcggcggacgataccgaaggcgacagcgaccgccccgccgacgag
ggtgacgacgagccacgcgatgcgagtccgcggccgagtccgggccgtggcgcccgcagt
gacgacgattcgagcgcgaacgaacagccccgagcgaatcccgaaggtgatgcggccgag
ggagggacgccgttgctacccggccaggaccgcgcggacgtcggggaggcggcggcgccg
gagctgtcgccaccggaggcgatagccgaacctgggtccgggaccgggtcgcgtgcgtcg
gcgtcgccgagcgtggacgcgaacggttctcgtgtacggacggagcggacggacgctgga
actggcggtgtgagtgtggacgcggcggcgtcggtgcgtgcggcgagcgcgcgcggtgcg
tcgtccgtcgaatcgcgggatctccggcagtcggttcgcgccggtgattcgtcggcgctc
gtgttgttcgtcgtggacgcgagcgcgtcgatgcggccggcgatgcgtgcggcgaagggg
accgtgctggaactgctggaggacgcctaccagcaccgggacgcggtcgggttcgtggcg
ttcgcgggcacggatgcggaggtgctcctgccgccgactgacagcgtgacgctcgccgct
cggcatctgaagtcgctcccgactggggaccggacgccgcttccggcgggtttgcggacc
gcggggcgcgtgcttgatcgtgcggacccggcggcgagcgtggtcgtggtggtgacggac
ggacgcgcgaacgtcgcggacggcagtccggtcgcggagacgcgcgccgcgggccgtgga
ttggccgagcgcgacgcgcacgtcgtcgtcgtcgccgccggtgaggacgacgggccgacg
gtcacggacgcgctggtcgaggcgagcggtggggagcgcgtcccgctcgccgccctcagc
gcggcgcgcgtcgacgagtccgtgcgagaggttcgggaccagtaa

DBGET integrated database retrieval system