KEGG   Haloarcula marismortui: pNG7022Help
Entry
pNG7022           CDS       T00211                                 

Gene name
adh1
Definition
zinc-binding dehydrogenase (EC:1.1.1.1 1.6.5.5)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7022 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7022 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7022 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7022 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7022 (adh1)
   00626 Naphthalene degradation
    pNG7022 (adh1)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7022 (adh1)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     pNG7022 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:complement(29525..30559)
Genome map
AA seq 344 aa AA seqDB search
MRASTLTDVGEITVEDRDRPDPADDEVLVQVGACSVCMTDYHMYHGTFAAETPLVLGHEG
AGTVAEVGADVDRFAVGDRVAINPTVPCNACSYCKKGETHLCENNTSIGGAGDTILDGAF
AEYVRVPAINVEDIGEMSFERAALAEPLACCVHGVEQADIKPGDSVGIIGAGPIGLLLLQ
AFRNAGAAPIVVSELDDERRELAADLGADAVIDPNEEDPEEAIPAAAGGPVNVGAEAIGL
VPTIKQANAVTAPGGSTLIFGVPDQEATMEVSPFDVFFDEVDYRGSFSLTTEDFERAITL
LRHERIDAETLITERIGLDDLPAAFERMGNAEGLKKVVVPGDSE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccagcacgttgaccgatgtcggcgaaattactgtggaagaccgcgaccgaccg
gaccctgcggatgacgaggttctcgttcaggtaggtgcctgtagcgtctgcatgaccgac
tatcacatgtatcacggcaccttcgccgccgaaacaccgctggtcctgggccacgaaggt
gccgggaccgtcgccgaagtcggtgccgacgttgatcgctttgcggtcggagaccgtgtc
gcaatcaaccccaccgtcccctgtaacgcctgttcgtactgcaagaagggggagacgcac
ctctgtgagaacaacacgagtatcggcggtgccggtgacaccatccttgacggtgctttc
gccgagtacgtccgcgttccggctatcaacgtcgaggacatcggcgagatgtccttcgaa
cgagccgcgctcgccgaaccgctcgcctgctgtgtccacggcgtcgagcaggctgacatc
aaaccgggagacagtgtcggtattatcggcgctggcccgattggattgctgctcctgcag
gcgttccgcaacgcgggcgctgccccaatcgtggtttccgaactcgatgacgaacggcga
gagctggccgccgacctcggcgcagatgccgtcatcgaccccaacgaagaagatcccgag
gaagcgatcccggcggcggccggtggaccggtcaacgtcggcgctgaggccatcgggctc
gtcccgacaatcaagcaggctaacgctgtgaccgcgcccggcggctcgacgctcatcttc
ggcgtcccggatcaggaagcgacgatggaagtcagtccgttcgatgtcttcttcgacgag
gtcgactaccgcggttcgttctccctgacgaccgaggacttcgagcgagcgataacactg
ctcagacacgaacgcatcgacgcagagacgctcatcaccgaacgtatcgggcttgacgac
ctcccagcagcgtttgaacggatgggcaacgctgagggactgaagaaagtagtcgttcca
ggggactccgagtga

DBGET integrated database retrieval system