KEGG   Haloarcula marismortui: pNG7101Help
Entry
pNG7101           CDS       T00211                                 

Gene name
adh8
Definition
alcohol dehydrogenase (EC:1.1.1.1 1.1.1.2)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00002  
alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Fatty acid degradation
Tyrosine metabolism
Glycerolipid metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7101 (adh8)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7101 (adh8)
   00040 Pentose and glucuronate interconversions
    pNG7101 (adh8)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7101 (adh8)
   00561 Glycerolipid metabolism
    pNG7101 (adh8)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7101 (adh8)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7101 (adh8)
   00930 Caprolactam degradation
    pNG7101 (adh8)
   00626 Naphthalene degradation
    pNG7101 (adh8)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7101 (adh8)
    1.1.1.2  alcohol dehydrogenase (NADP+)
     pNG7101 (adh8)
Exosome [BR:hma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   pNG7101 (adh8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:complement(100207..102210)
Genome map
AA seq 667 aa AA seqDB search
MIYMRGRPRSSVHCLFVGAGSIAAEYAAELADSPLSLAGVCDLEEDRATALAAAHDCPAF
TDLDTALSAVDAPLVVNLTNHAAHAPVTRTALEAGRHVYSQKPLALDEAAAAELLALAQD
RNLALGCAPGTPDAPSQRRAGQMLADGRMGPVQLGYAHAHVGRVTDWHDRPGSFLSIGPL
YDGGVYPLALLVSWFGPVKSVQTATTLDSWPEREPERPSAPSHVEAMLSFDGGLTVRLTA
SFYAPHRSREFYGLELHGDDGSLYLRGTGAMADSTTAVQYGRIGREYIDAPAQHPTQPYR
YLDPVESLAASVTRGTPSRMTGRRGAHIVAVCNAIETAAETGESETVSDYGTAADSTPPP
TVTPDRDWDGSREQAIRLPAIGFGCSRYRDGTYIDRADSIAAALDAGYRLLDSAELYGNE
HRIGRILAAPGAPDRRRVFILGKVWRTNHRRKHMLTACRSSLDELGIDAFDCYALHWPEA
LAHRGSLTRLAEKSVARQEALTFPKNDRGDIETDSVSLQRAWENLEALHERGWTRTLGLC
NVSQTQLETVIETGTVRPALVQVERHPYQPQTDLIEYCHERGIRVVAHSPLSAPGLLDEP
VLAAIAEEYGLSPAGVVLAWNVTQGVVPIPSSTTPSHIVENLAAAGQRLDAEACARIEAL
RQPDFER
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgatatatatgcgaggacgcccgcgttcgagtgtgcattgtctgttcgtcggtgcgggc
agtatcgcggcggagtacgcggccgaactggcagacagcccgctctcgctggcgggcgtc
tgcgacctcgaagaagaccgggcgacagcactcgccgcggcgcacgactgcccggccttt
accgacctcgacaccgcgctttccgccgttgacgcgccgctggttgtgaacctgacgaac
cacgccgcccacgcaccggtgacccgaacggcgctcgaagccggacggcacgtctactcg
caaaagcccctcgcactggacgaggcggcggccgcggagctcttggcgctggcccaagac
cggaatctggcattgggctgtgccccggggacgcccgatgcgccctcacagcgtcgcgcc
gggcaaatgctcgccgacggccgtatgggacccgttcagctggggtacgcccacgcccac
gtcggtcgcgtgacagattggcacgaccgacccggctcgtttctctctatcgggccgctg
tacgacgggggcgtctatccgctcgcgctgctggtctcgtggttcggccctgtcaaatcc
gttcagaccgcaacgacactcgatagctggcccgagcgagagccagagcgaccgtctgcg
cccagccacgtcgaggcgatgctttcgttcgacggagggctgacggtccggctgaccgcg
agcttctacgcgccacaccggagccgcgagttctacgggctcgaactccacggtgacgac
gggtcgctatatctccgtgggaccggcgcgatggctgatagtacgaccgccgtgcagtac
ggtcgtatcggccgcgaatacatcgatgctcccgcacagcaccccacgcaaccctaccgc
tatctcgacccggtcgagtcgcttgcggccagtgtcacccgggggaccccatcgcggatg
acgggtcgccgcggtgcccacattgttgcagtctgtaatgcgattgagacggctgccgag
acgggcgagtctgagactgtgtccgactacggcacggcggcggactcaacgccaccgccg
accgtcaccccggacagagactgggacgggagccgggagcaagcgatccggctcccggct
atcggctttggctgttcccgatatcgtgacggaacgtacatcgaccgtgcggactctatc
gcggcggccctcgacgccggctaccgactgcttgacagcgctgaactgtacgggaacgag
caccgtatcggccgcattctggctgcccccggtgcccccgaccggcgtcgggtgttcata
ctcgggaaagtctggcgcacgaaccaccgtcgaaagcacatgctgacggcctgtcggagc
agtctcgacgaactgggtatcgacgcgttcgactgctatgccctgcactggcccgaggcg
ttagctcatcgcgggtcgctaacgcgactggccgagaaatcggtcgcgcgtcaggaggcg
ttgaccttccccaaaaacgatcgtggcgacatcgagacggactcggtctcactccagcgc
gcctgggagaatctggaggccctccacgaacgaggctggacgcgcacgctcgggctctgt
aacgtctcgcagacacaactggagacagtcatcgaaacggggactgtcaggccggcgctg
gtacaggtcgagcgccatccgtaccagccacagacagacctcattgaatactgccacgaa
cgcggcatcagggtcgtcgctcactccccgctgtcagcccccggactgctcgacgagcct
gttctggcggctatcgcggaggagtacggcctatcaccagccggcgtggtactggcctgg
aacgtcacacagggcgtcgttccgattccgtccagtacgacaccgtcccacatcgtcgag
aacctcgccgccgctgggcagcgactcgacgcagaagcgtgtgcccgcatcgaggcactt
cgacagccggatttcgagcggtaa

DBGET integrated database retrieval system