KEGG   Haloarcula marismortui: pNG7103Help
Entry
pNG7103           CDS       T00211                                 

Gene name
adh7
Definition
putative zinc-binding dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7103 (adh7)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7103 (adh7)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7103 (adh7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7103 (adh7)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7103 (adh7)
   00626 Naphthalene degradation
    pNG7103 (adh7)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7103 (adh7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:103269..104258
Genome map
AA seq 329 aa AA seqDB search
MSARTLYFTGGKSVRVDEEAVPDPGPSEVRVRTELSGISPGTELLVYRGEVDSELATDET
IDALDGTFSYPLQYGYAAVGCVTAVGDAVDDDWLDQRVFAFNPHESHFLAEPSSLIPTTL
PPEQAVFIPNVEAAVNFVMDARPRIGARVVVFGQGPVGLLTTGLLADFPLASLVTVDPCA
GRRRLSEALGADRSVSPGNLDDDDADITFELSGNPTALDRAIDATGYAGQVIVGSWYGSK
DVSLDLGHHFHRSHIRLRSSQVSRIDPDHADRWDKDRRLDVVRSWLSDTDLSALLTHEID
IERAAEAYQLLESRPDDAVQVVLTYNGHP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagaacgctgtactttaccggcgggaagtcggttcgggttgacgaagaagcg
gtgcctgaccccggaccatcggaggtccgtgttcgaaccgaactctcaggaatcagtccc
ggaacagagctgttggtgtaccgtggtgaggtcgattcggaactcgcgaccgacgagacg
atcgacgcccttgatggtacgttctcgtatccactgcagtacggctacgccgctgtcggc
tgtgtcacggccgtcggggacgcggttgacgacgactggctcgaccagcgtgtgttcgcg
ttcaacccacacgaaagccacttcctcgccgagccgtcgtcgcttattcccacgacgtta
ccgccggagcaggcggtgttcatcccgaacgtcgaagcagcggtcaacttcgtgatggac
gctcgaccgcgtatcggggctcgggttgtcgtcttcggtcaggggccggtgggcctgttg
acgaccgggctgctggccgattttccgctggcgtcgctcgtgacggtcgatccctgtgcg
ggccgccgtcggctctcggaagcgctcggggcagaccgctcagtctctcccgggaatctc
gatgacgacgacgccgacatcacgttcgagctctcggggaacccaaccgcactcgacaga
gcgatcgacgccactggctatgccggtcaggtcatcgtcggttcgtggtacggctcaaag
gatgtctcgcttgacctcggacatcacttccaccggagccacatccgccttcgcagcagt
caggtgagccgcatcgatccggatcacgccgaccgctgggacaaggaccggcggctggat
gtcgtccggtcgtggctgagcgacactgacctctcggcgctactgacacatgagatcgat
atcgagcgtgcagccgaagcgtatcaactgctagagagccggccagacgacgctgtacag
gtagtgttgacgtacaacggacacccgtga

DBGET integrated database retrieval system