KEGG   Haloarcula marismortui: pNG7257Help
Entry
pNG7257           CDS       T00211                                 

Gene name
thrC2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00260  Glycine, serine and threonine metabolism
hma00750  Vitamin B6 metabolism
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01230  Biosynthesis of amino acids
Module
hma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    pNG7257 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    pNG7257 (thrC2)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     pNG7257 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAV44958
UniProt: Q5V694
Position
pNG700:complement(269678..270937)
Genome map
AA seq 419 aa AA seqDB search
MGMTQVTTLECTLCGAEYDPNRIIYTCPEHEGVKGILEVTYDYDAIDDAFDGDLGGPIAS
QWKYEAFLPVAADADIVTLNEGGTDLFDAPNLSAALGVETLVKDDGRNPTGCFKDRASAI
AVTKAKHAGRDIITCASTGNAAASLSGYAARGGMDCRIFVPGDAPTGKLAQPLVYGADVL
AVNGNYDEAYDLSVEVTEKYGWYNRNAAINPFQVEGKRTVGHELADQSIARGHVPDWVVF
SMGDGCTIAGAWKGFKEFYDLGYVDDHPKMLGVQAEGASAIHDAFHNHEDIDDIAETLAD
SIAVGRPRNTIKACRALEQSGGTSVLVSDEEILEAETLLGSTEGIYSEPAGAAPIAGVQT
ALDRGIIEQDETVVVVSTGFGLKDTKSAEKATGGVDRIDPEIAEVEGLYGTAEEAAADD
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgacgcaagtcacaaccctcgagtgtacactctgtggggcagagtacgacccg
aaccggatcatctacacctgtcccgaacacgagggcgtgaagggaattctcgaggtgacg
tacgactacgatgctatcgatgatgcgtttgacggcgacctcggcgggccgatcgcaagt
caatggaagtacgaggcgtttctgccagtcgcagcggacgccgatatcgtgacgctcaac
gagggcgggacggacctcttcgacgcgccgaatctcagcgctgcgctgggcgtggagaca
ctggtcaaagacgacggacggaacccgaccggctgcttcaaggaccgcgccagcgctatc
gcggtcacgaaagcaaaacacgccgggcgcgatatcatcacctgcgcctccaccgggaac
gccgccgcgtcactgtcgggctatgccgcccgcggggggatggactgccgtattttcgtc
cccggtgacgccccgacggggaaactcgcacagccgctcgtctacggcgcggatgtcctt
gctgtcaacggcaactacgacgaagcctacgacctcagcgtcgaggtcaccgagaagtac
ggctggtacaaccgcaacgcggctatcaatccgttccaggtcgagggcaagcgcaccgtc
ggccacgagctcgcagaccagtctatcgcccgcggacacgtcccggactgggtcgtgttt
tcgatgggcgacggctgtacgattgccggggcctggaaggggttcaaggagttctacgac
ctcggctacgtcgatgaccaccccaaaatgctaggggttcaggccgaaggggcgtcggcg
atccacgacgccttccacaaccacgaggatatcgacgatatcgccgaaacgctggccgat
tcaatcgcagtcggacggccgcggaacacgattaaggcttgccgcgcgctggaacagagc
ggtggcaccagcgtgctggtctccgatgaagagattctggaagccgaaacgctacttggc
agcaccgaaggaatctactccgagccggcgggagcagcgcctatcgcgggcgttcagacg
gcgctcgaccggggaatcatcgaacaggacgaaacggtcgtcgtggtgtccaccggcttc
ggcctgaaggacacgaaaagcgccgagaaggcgaccggcggggtggatcgaatcgacccc
gaaatcgcagaggtcgaaggtctgtacggcacggccgaagaagccgcagccgacgactga

DBGET integrated database retrieval system