KEGG   Haloarcula marismortui: pNG7278Help
Entry
pNG7278           CDS       T00211                                 

Gene name
adh12
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7278 (adh12)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7278 (adh12)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7278 (adh12)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7278 (adh12)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7278 (adh12)
   00626 Naphthalene degradation
    pNG7278 (adh12)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7278 (adh12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:complement(289525..290679)
Genome map
AA seq 384 aa AA seqDB search
MFLYLYSIFGNCFHPITRPGGCDRRHENGFPQPTRNGSMRAAIYRGPGDITVEEVPRPEI
ESPTDAIVRVTHTAVCGSDLWFYRGQSDREEGSRVGHEPMGIVEEVGDDVRSVEPGDRVF
APFVVSCGRCEFCRKGLHTSCVNGDSWGGDNGGGQGEYVRATEADGTLVRVPDRHADDED
TLEAILPLTDVMGTGHHAAVSAGVSEGDTCIVVGDGAVGLCGVLAARRLGAERIIAMGHH
EDRLELAESFGATETVAARGQDAVDAADDLTNGGANHVLECVGAASAMETAIDVCRPGGT
VGYVGVPHGLDDSGLDMFSLFGDNIGLNGGIAPVRAYADELLADVLQGTLDPSPIFTKTV
DLNGVPEGYQAMDEREAIKVLVKL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtatttatattccatctttggtaattgttttcatccaataacacggccgggc
ggatgcgacagacggcatgagaacggttttccacagccgacccgaaacggatctatgcgc
gcagccatctaccgtggccccggtgatatcaccgtcgaagaggttccccgacccgaaatc
gaatcgccaactgacgcgattgtacgcgtgacccacactgccgtctgtggctccgacctg
tggttctaccgcggccagagcgaccgtgaagagggctcccgcgtcggccacgaaccgatg
ggtatcgtcgaggaagtcggcgacgacgtgcgctcagtcgaacccggcgaccgggtgttc
gccccgttcgtcgtcagctgtggccggtgtgagttctgtcggaagggactgcacacgtcc
tgtgtcaacggcgactcatggggcggcgacaacggcggcggccagggcgagtacgtccga
gcaacggaagccgacgggacgctcgtccgcgtcccagaccgccacgccgacgacgaggac
acgctggaagcgattctgccgctgacagacgtgatgggaacgggccaccacgcggcggta
agcgccggtgtcagtgaaggcgacacctgtatcgtcgtcggcgacggggccgttggacta
tgtggcgttctcgcggcgcgacgcctcggtgcggaacgcatcatcgcgatggggcaccac
gaggaccgcctcgaactcgctgagtcgttcggtgcgacagagaccgtcgccgcccgtggt
caggacgccgtcgacgccgcggacgacctgactaacggcggtgcaaatcacgtcctcgaa
tgtgtcggtgcggcctcggcaatggagaccgctatcgatgtctgtcgtcctggcgggacc
gtcggctacgtcggcgtcccacacggcctcgatgattccggattggacatgttctcgctg
ttcggcgataacatcgggctcaacggtggcatcgcaccggttcgtgcctacgccgatgaa
ctgctggccgatgtgctgcagggcacgcttgacccgtcaccgatcttcacgaaaacagtc
gacctcaacggcgttccagaagggtatcaggcgatggacgagcgcgaggcgatcaaagtt
ctcgtcaagctgtaa

DBGET integrated database retrieval system