KEGG   Haloarcula marismortui: pNG7289Help
Entry
pNG7289           CDS       T00211                                 

Gene name
adh6
Definition
zinc-binding dehydrogenase (EC:1.1.1.1 1.6.5.5)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7289 (adh6)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7289 (adh6)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7289 (adh6)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7289 (adh6)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7289 (adh6)
   00626 Naphthalene degradation
    pNG7289 (adh6)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7289 (adh6)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     pNG7289 (adh6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:complement(302877..303893)
Genome map
AA seq 338 aa AA seqDB search
MSDTMQAAVVPEPGDDFEVVERDVPEPDPGEVRVSVDACGICHSDVFAKEGTNPVVSYPR
VPGHEVAGHVDAVGDAVDAWDVGDRVGVGWHGGHCSTCDQCRQGNFLQCENGEITGLSYD
GGYAEYMTAPSEALAKIPESLDAAAAAPLLCAGVTTFNALRNSDANVGDLVAVQGVGGLG
HLGIQYAHAAGFETAAISRTPEKESLAKELGADHFINAAETDAGQRLQELGGADVVLATA
PSSDAISSIVSGIGVDGSVVVVGVPGEPVAVSGQQLVQTRGAVEGWASGHARDSQDTLEF
SSLRDIAPEIETYPLEEVNEAYGRMIDNEARFRAVLEL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacaatgcaagcggcagtcgtacccgagccaggggatgacttcgaggtcgtc
gaacgagacgtacccgagccggaccccggcgaggtacgggtctcggtcgacgcctgtggc
atctgtcacagcgacgtgttcgccaaagaagggaccaacccggtcgtctcctatccgcgg
gttcccggccacgaggtggcgggccacgtagacgccgtcggcgacgctgtcgacgcctgg
gacgtgggcgacagagtcggcgtcggctggcacggcggccactgttcgacgtgtgaccag
tgtcggcaggggaacttcctccagtgtgagaacggtgaaatcactgggctgagctacgac
ggcgggtacgcggagtacatgaccgcaccgtcggaggcgctcgcaaagattccggaatca
cttgatgcggcggccgcggcaccgctcctctgtgcgggcgtgacgacgttcaacgcgctg
cggaacagcgatgcgaacgtcggcgacctcgtcgccgtgcagggtgtcggcggcctcggt
cacctcggtatccagtatgcacacgcggctggcttcgagacggccgcgatctcccgaacg
cccgaaaaagaatcgctggcgaaagagcttggagccgaccacttcattaacgcggcggag
acagacgccgggcagcgactgcaggagcttggtggggccgatgtggtgctggcgacggca
ccgtcgagtgacgccatcagttccatcgtcagcggcatcggtgtcgacggctccgtcgtg
gttgtgggcgtccccggcgaaccggtagcggtgagcggacagcaactcgtccagacccgg
ggcgctgtcgagggctgggcctccggacacgcacgcgactcacaggacacgcttgagttc
agttcgcttcgcgacatcgcaccggaaatagagacctacccgctcgaagaggtgaatgag
gcctacggccggatgatcgacaacgaagcacgattccgggccgtgcttgaactgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system