KEGG   Haloarcula marismortui: pNG7314Help
Entry
pNG7314           CDS       T00211                                 

Gene name
adhC
Definition
formaldehyde dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:hma01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hma00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hma00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hma00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:hma00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:hma00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:326844..328007
Genome map
AA seq 387 aa AA seqDB search
MSMNAVVYKGPKEVAVEEVDEPEIEHPNDVLIDITTSCICGSDLHMYEGRTAAEPGIVFG
HENMGIVTEVGEAVSSLEEGDRVVAPFNVACGFCENCEAGYTGFCTNVNPGFAGGAYGYV
AMGPYKGGQAEKLRIPYADFNALKLPDGDEHEDAFSLLADIFPTGWHGTELANLEPGDSV
AIYGAGPVGLMAAYSAKIKGAAEIYSVDRVPSRLELAEEHCDATPINFEDGNPVEQIKAQ
HGGGVDKGVDAVGYQAIDPDKEADDAYDPARENPAVVINNLIRTVKPTGELGIPGLYVPE
DPGAPDDMAAQGRLGIDFGLLFEKGQALGTGQCNVKSYNRELRDLIVEGRADPSWVVSHR
VGLEEAPEMYEAFDNREEGVTKVLLEP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaacgctgttgtgtataagggaccgaaagaagtggctgtcgaagaagtcgat
gaaccagaaatagagcacccgaacgacgtacttatcgacatcacgacgtcgtgcatctgt
gggtccgacctccatatgtacgaggggcggacggcagcggaacccggtatcgtgtttgga
cacgagaacatgggcatcgtcaccgaagtcggggaggccgtctcctcgttggaggaaggc
gaccgcgtcgttgcgccgttcaacgttgcctgtggcttctgtgagaactgcgaggctgga
tacaccggcttctgtacgaacgtcaatcctggcttcgccggcggagcctacgggtacgtc
gccatggggccatacaagggcgggcaggccgagaagctccgtattccctacgcagacttc
aacgcgctcaaactcccggatggggatgagcacgaggacgccttttcgctgctggcggac
atcttcccgacaggctggcacgggacagaactcgcaaacctcgaaccgggcgactccgtc
gccatctacggggccggtccggtcgggctgatggccgcttacagcgcgaaaatcaagggc
gcagcggagatttactccgtagaccgcgttccgagccggctcgaactcgcggaagaacac
tgcgacgcgacgccaatcaacttcgaggacggcaatccggtcgagcagatcaaagcgcaa
cacggcggtggcgtcgacaagggcgtagacgctgttggctatcaggccatcgacccggat
aaggaagctgacgacgcgtacgacccggcgcgagagaacccggccgtcgtcatcaacaac
ctcatccgaacggtgaaaccgaccggcgaactggggattccagggctctacgttccagag
gacccgggcgcgccggacgacatggccgcgcagggccgcctcggtatcgacttcggactg
ctcttcgagaaggggcaggcgctcgggactggccagtgtaacgtcaagtcctacaaccgg
gaactacgtgacctgattgtcgagggtcgcgccgaccctagctgggtcgtctctcaccgg
gtcgggcttgaagaggctcccgagatgtacgaggccttcgacaacagagaagaaggtgtc
accaaggtcctgctggagccctga

DBGET integrated database retrieval system