KEGG   Haloarcula marismortui: pNG7314Help
Entry
pNG7314           CDS       T00211                                 

Gene name
adhC
Definition
formaldehyde dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7314 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7314 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7314 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7314 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7314 (adhC)
   00626 Naphthalene degradation
    pNG7314 (adhC)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7314 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:326844..328007
Genome map
AA seq 387 aa AA seqDB search
MSMNAVVYKGPKEVAVEEVDEPEIEHPNDVLIDITTSCICGSDLHMYEGRTAAEPGIVFG
HENMGIVTEVGEAVSSLEEGDRVVAPFNVACGFCENCEAGYTGFCTNVNPGFAGGAYGYV
AMGPYKGGQAEKLRIPYADFNALKLPDGDEHEDAFSLLADIFPTGWHGTELANLEPGDSV
AIYGAGPVGLMAAYSAKIKGAAEIYSVDRVPSRLELAEEHCDATPINFEDGNPVEQIKAQ
HGGGVDKGVDAVGYQAIDPDKEADDAYDPARENPAVVINNLIRTVKPTGELGIPGLYVPE
DPGAPDDMAAQGRLGIDFGLLFEKGQALGTGQCNVKSYNRELRDLIVEGRADPSWVVSHR
VGLEEAPEMYEAFDNREEGVTKVLLEP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaacgctgttgtgtataagggaccgaaagaagtggctgtcgaagaagtcgat
gaaccagaaatagagcacccgaacgacgtacttatcgacatcacgacgtcgtgcatctgt
gggtccgacctccatatgtacgaggggcggacggcagcggaacccggtatcgtgtttgga
cacgagaacatgggcatcgtcaccgaagtcggggaggccgtctcctcgttggaggaaggc
gaccgcgtcgttgcgccgttcaacgttgcctgtggcttctgtgagaactgcgaggctgga
tacaccggcttctgtacgaacgtcaatcctggcttcgccggcggagcctacgggtacgtc
gccatggggccatacaagggcgggcaggccgagaagctccgtattccctacgcagacttc
aacgcgctcaaactcccggatggggatgagcacgaggacgccttttcgctgctggcggac
atcttcccgacaggctggcacgggacagaactcgcaaacctcgaaccgggcgactccgtc
gccatctacggggccggtccggtcgggctgatggccgcttacagcgcgaaaatcaagggc
gcagcggagatttactccgtagaccgcgttccgagccggctcgaactcgcggaagaacac
tgcgacgcgacgccaatcaacttcgaggacggcaatccggtcgagcagatcaaagcgcaa
cacggcggtggcgtcgacaagggcgtagacgctgttggctatcaggccatcgacccggat
aaggaagctgacgacgcgtacgacccggcgcgagagaacccggccgtcgtcatcaacaac
ctcatccgaacggtgaaaccgaccggcgaactggggattccagggctctacgttccagag
gacccgggcgcgccggacgacatggccgcgcagggccgcctcggtatcgacttcggactg
ctcttcgagaaggggcaggcgctcgggactggccagtgtaacgtcaagtcctacaaccgg
gaactacgtgacctgattgtcgagggtcgcgccgaccctagctgggtcgtctctcaccgg
gtcgggcttgaagaggctcccgagatgtacgaggccttcgacaacagagaagaaggtgtc
accaaggtcctgctggagccctga

DBGET integrated database retrieval system