KEGG   Haloarcula marismortui: pNG7351Help
Entry
pNG7351           CDS       T00211                                 

Gene name
adh13
Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
K00344  NADPH2:quinone reductase [EC:1.6.5.5]
Organism
hma  Haloarcula marismortui
Pathway
hma00010  Glycolysis / Gluconeogenesis
hma00071  Fatty acid degradation
hma00350  Tyrosine metabolism
hma00625  Chloroalkane and chloroalkene degradation
hma00626  Naphthalene degradation
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7351 (adh13)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7351 (adh13)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7351 (adh13)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7351 (adh13)
   00626 Naphthalene degradation
    pNG7351 (adh13)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7351 (adh13)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     pNG7351 (adh13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 Urocanase ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AAV45045
UniProt: Q5V607
Position
pNG700:364052..365140
Genome map
AA seq 362 aa AA seqDB search
MWYRHTIRMRAAVLEEYEEPLAIRDVERPDPDPDGVVAKVDACGVCRSDWHGWVGNWDWF
DYKPPRGHILGHEPSGTVVEVGENVDTVKEGDTVAIPFNFACGHCHECRVGYENLCENHL
GLGFQPGAPGAFAEEVPIPNADINAVKLPDGVDPVEVAGMGCRFMTSYRGMAHQADVSRG
EYVVVQGLGGIGLSAVHIADALGGNVIGVDLMDEKLEMAEELGAIDTVNAAEEDDVVQAV
RDITDGGAHVSLDALGIEETCQNAIESLRTRGRHVQIGLTTKEQRGYNSLPTDTIVMNEI
QVQGSSGLPPSKYGEMFRMVENGKLDPGAVITDKIGLEGVSDELAAMTDYETIGIPVVNE
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtggtaccgtcacacaatacgtatgcgagcagctgtgttagaggagtacgaggagccg
ctagctatcagagacgtcgaacgcccggacccggacccggatggcgtcgtcgctaaggtc
gatgcctgcggtgtctgccggagcgactggcacggatgggtcggcaactgggactggttt
gattacaagccaccgcggggccatattctcggccacgaaccgtcggggacggtcgtcgaa
gtcggcgagaatgttgacacagtcaaagaaggggatacggtcgccatcccgttcaatttt
gcctgtggccactgtcacgagtgccgtgttggctatgaaaacctctgtgagaaccatctg
gggctcggcttccagcccggagcgccgggggcctttgccgaagaagtcccgattccaaac
gccgacatcaacgctgtgaagctccctgatggtgtggaccccgtcgaggtcgctggcatg
gggtgccgcttcatgacgtcgtaccgtggaatggcccatcaggccgacgtgagtcgcggt
gagtacgtcgtcgttcaggggctcggtggtatcggactgtcagcggtccacatcgcggac
gcactgggtggaaacgtcatcggtgtcgacctgatggacgaaaaactcgaaatggctgaa
gagctgggtgccatcgacaccgtcaacgcagctgaagaggacgatgtcgtacaggcggtc
cgagatatcacggacggcggcgcgcacgtctctctagacgcactggggattgaggagacc
tgccagaacgctatcgaatcgctcagaacgcgcgggcgacacgtccagatcggcctaacg
acgaaagaacagcgagggtacaactcgctgcccacggatacgatcgtaatgaacgagatt
caggtgcagggctctagcggcctcccgccgtcgaagtacggtgagatgttccggatggta
gagaacggcaagctcgaccccggtgccgtcataaccgacaaaatcggtctggagggcgtt
agcgacgaactggctgccatgaccgactacgagacaatcgggattcccgttgtcaacgag
ttcgcctga

DBGET integrated database retrieval system