KEGG   Haloarcula marismortui: pNG7351Help
Entry
pNG7351           CDS       T00211                                 

Gene name
adh13
Definition
zinc-binding dehydrogenase (EC:1.1.1.1 1.6.5.5)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pNG7351 (adh13)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pNG7351 (adh13)
  Lipid metabolism
   00071 Fatty acid degradation
    pNG7351 (adh13)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pNG7351 (adh13)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pNG7351 (adh13)
   00626 Naphthalene degradation
    pNG7351 (adh13)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pNG7351 (adh13)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     pNG7351 (adh13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pNG700:364052..365140
Genome map
AA seq 362 aa AA seqDB search
MWYRHTIRMRAAVLEEYEEPLAIRDVERPDPDPDGVVAKVDACGVCRSDWHGWVGNWDWF
DYKPPRGHILGHEPSGTVVEVGENVDTVKEGDTVAIPFNFACGHCHECRVGYENLCENHL
GLGFQPGAPGAFAEEVPIPNADINAVKLPDGVDPVEVAGMGCRFMTSYRGMAHQADVSRG
EYVVVQGLGGIGLSAVHIADALGGNVIGVDLMDEKLEMAEELGAIDTVNAAEEDDVVQAV
RDITDGGAHVSLDALGIEETCQNAIESLRTRGRHVQIGLTTKEQRGYNSLPTDTIVMNEI
QVQGSSGLPPSKYGEMFRMVENGKLDPGAVITDKIGLEGVSDELAAMTDYETIGIPVVNE
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtggtaccgtcacacaatacgtatgcgagcagctgtgttagaggagtacgaggagccg
ctagctatcagagacgtcgaacgcccggacccggacccggatggcgtcgtcgctaaggtc
gatgcctgcggtgtctgccggagcgactggcacggatgggtcggcaactgggactggttt
gattacaagccaccgcggggccatattctcggccacgaaccgtcggggacggtcgtcgaa
gtcggcgagaatgttgacacagtcaaagaaggggatacggtcgccatcccgttcaatttt
gcctgtggccactgtcacgagtgccgtgttggctatgaaaacctctgtgagaaccatctg
gggctcggcttccagcccggagcgccgggggcctttgccgaagaagtcccgattccaaac
gccgacatcaacgctgtgaagctccctgatggtgtggaccccgtcgaggtcgctggcatg
gggtgccgcttcatgacgtcgtaccgtggaatggcccatcaggccgacgtgagtcgcggt
gagtacgtcgtcgttcaggggctcggtggtatcggactgtcagcggtccacatcgcggac
gcactgggtggaaacgtcatcggtgtcgacctgatggacgaaaaactcgaaatggctgaa
gagctgggtgccatcgacaccgtcaacgcagctgaagaggacgatgtcgtacaggcggtc
cgagatatcacggacggcggcgcgcacgtctctctagacgcactggggattgaggagacc
tgccagaacgctatcgaatcgctcagaacgcgcgggcgacacgtccagatcggcctaacg
acgaaagaacagcgagggtacaactcgctgcccacggatacgatcgtaatgaacgagatt
caggtgcagggctctagcggcctcccgccgtcgaagtacggtgagatgttccggatggta
gagaacggcaagctcgaccccggtgccgtcataaccgacaaaatcggtctggagggcgtt
agcgacgaactggctgccatgaccgactacgagacaatcgggattcccgttgtcaacgag
ttcgcctga

DBGET integrated database retrieval system