KEGG   Haloarcula marismortui: rrnAC0196Help
Entry
rrnAC0196         CDS       T00211                                 

Gene name
argE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.16)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hma  Haloarcula marismortui
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hma01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hma00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(175360..176487)
Genome map
AA seq 375 aa AA seqDB search
MAFDIPSFHRRAVETRSDEHVDDMRSLLVDTLEDAGEYPEIDDLGNVVVSRGDEDGTHIL
LNTHIDTVPPHLPYERRTEPPGPDETIDGTGGDGDGDIVCGRGACDAKGPLAALLDAFLT
VTPDDGRVTLAISTDEETTQTGGAHLADTIDADGYIVGEPTGLDVCTAARGQFEGTVTIH
GESAHAADPGSGHNAIRAAAPILQAMESYEEKKGPGEHETLGYPILTPSMVEGGEATNQV
PAECTITFDRRSVPPETSESFCADLQAHLEQWLPESMGLTVDLIRPDTPFPEAFATDTDA
ELVRTLQEASGGGVRQFGAATEASYFANNGPTVVFGPGDLSDETGAVAHSKREYVRLSEV
RTAARAVRETVERLV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgacatcccatcgttccaccggcgggccgtcgaaacgcggtcagacgagcac
gtcgacgacatgcgctcgctgctggtcgacacgctggaagacgccggcgagtacccggag
atagacgacctcgggaacgtcgtcgtctcgcggggcgacgaggacggaacgcatatcctg
ctcaatacgcacatcgacaccgtgccgccgcatctgccctacgagcggcggacagagccg
ccggggccagacgagactatcgacggcactggcggtgacggggacggcgatatcgtctgt
ggccgcggagcctgcgacgcgaaagggccgctcgcggcgctcctcgatgcgttcctcacc
gtgacgcccgacgacggccgggtcacactggcgatttctaccgacgaggagacgacacag
accggcggcgcacacctcgctgacaccatcgacgccgacggctacatcgtcggcgagccg
actggcctcgatgtgtgtacggccgcccgcggccagttcgaggggacggtcaccatccac
ggcgagagtgcccacgccgccgaccccggcagcggccacaacgcgattcgagccgccgcg
ccgatactgcaggcgatggagagttacgaggaaaagaaagggccgggcgaacacgaaacg
cttggttaccccattctcaccccgtcgatggtggagggcggcgaggcgaccaatcaggtc
ccagccgaatgcactatcacgttcgaccggcggagcgtcccgccggagaccagcgagtca
ttctgtgcggacctgcaggcccacctcgaacagtggctcccggaatcgatgggcctcacc
gtggacctcatccgcccggatacgccgtttcccgaggcgtttgcaaccgacaccgacgcc
gaactggtccgcacactgcaggaagctagcggcggcggggtccggcagttcggggccgcg
acagaagcttcgtatttcgcaaacaacgggccgactgtggtgttcggccccggcgacctg
agcgacgaaacaggtgctgtcgcgcactcgaaacgcgagtacgtccggctctcggaagtt
cgaaccgccgcacgagctgtgcgagagacagtcgaacggctggtctaa

DBGET integrated database retrieval system