KEGG   Haloarcula marismortui: rrnAC0249Help
Entry
rrnAC0249         CDS       T00211                                 

Gene name
pfk3
Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hma  Haloarcula marismortui
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    rrnAC0249 (pfk3)
Enzymes [BR:hma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     rrnAC0249 (pfk3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(225062..226078)
Genome map
AA seq 338 aa AA seqDB search
MLVRQLIGRTLSGTVTMCAGPFRSVLNMLHRPQWETAMIAPLPAVDMRVICAGHVNWDVT
LHVDHLPKPDGEGRITDRSQSSGGSASNAAVALAGLDADPLVLGSVGRDDHGTMARRELA
ATGVETLLIESDEATAVKYLIVDENGDVAVLGNDGANEAFNASDLPAETLAEADHLHLTG
QNPTTAATLARDAAAADVPVSFDPGRRLPYRDYSSVLSHAEILFCNDREADHARDSGLFE
TVPTVVVKHGDCGATAHIGDQTVTNAGYPIESVDTAGAGDAFAAGYLLASAQETDPERAL
AVANACGALAAQSSGARTTLDWESVWELVDSGQPPETA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctggtccgacaactcattgggaggacgctatcggggaccgttaccatgtgcgccggt
ccgttccggtcagtgttaaatatgctgcatagaccgcagtgggaaactgctatgatagcg
cccctcccagccgtggatatgcgcgtcatctgtgccggccacgtcaactgggacgtgacg
ctccacgtcgaccaccttccgaagcccgacggcgaggggcgcatcactgaccggtcacag
tctagcggggggagcgcatcgaacgcggccgtcgcactggccggacttgatgcggacccg
ctagtcctcggtagcgtcggccgggacgaccacggcaccatggcccgtcgcgaactggca
gccaccggcgtcgagacgttgctgatcgagtcggacgaggcgacggccgtgaaatatctc
atcgtggacgagaacggcgatgtcgcggtgcttggaaacgacggggccaacgaggcgttc
aacgcgtcggacctcccggccgagaccctagccgaggccgaccacctccacctgaccggc
caaaatccgacgacggctgcgacgctcgcacgcgacgccgcggccgcggatgttccggtg
agcttcgaccccggccggcggcttccataccgcgattactcatcggtgctctcacatgcg
gagatcctgttttgcaacgaccgggaggccgaccacgccagagacagcgggctcttcgag
acagtgccgacagttgtggtcaagcacggggactgcggcgcaacggcccacatcggcgac
caaacggtcacgaacgctgggtatccaatagagtctgtggacactgcaggcgcgggcgac
gcgttcgctgccgggtatctgctcgccagcgcacaggagactgacccggagcgtgcgctc
gcagtcgccaacgcctgtggcgcactcgcagcgcagtcatccggcgcacggacgacactc
gactgggagtccgtgtgggagcttgtcgacagcggccaaccgcccgaaacggcctaa

DBGET integrated database retrieval system