KEGG   Haloarcula marismortui: rrnAC0272Help
Entry
rrnAC0272         CDS       T00211                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hma  Haloarcula marismortui
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hma01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hma00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:243806..245074
Genome map
AA seq 422 aa AA seqDB search
MNVRTIADLGPDERAAFFDRDAGVDAVRDDVRDIVSQVHEEGDVALRRFAEEFDDVSVGN
IDITDAAERAYEEIDDDVREAIEDAAANIRAFHERQVPEDWRDDFEGRELGRRFRPLDSA
GVYAPGGTAAYPSSALMGVIPAKVAGVEHVAVATPPAEEVNPVTLAAIHVAGADAVYQVG
GAQAIAALAYGTETVSATDIVVGPGNRWVTAAKAEVRGDVAIDFLAGPSEVMVVADGDAD
PELVAADLIAQAEHDENASVVAVTDDADLAEQVVDAVDEQADGREREAVIRAALDNDTSG
VLLARSMSEAVLFAEEYAAEHLSIQAADDESLLERIPSAGSVFLGPYSPVAAGDYATGTN
HVLPTGGNARVTGGLSVDTFVRSTTVQRLSEDSLGDIADTITTLAEAEGLDAHAESVRKR
FE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacggacgatagctgaccttggtcccgacgaacgggccgctttcttcgaccgc
gacgccggcgtcgacgccgttagagacgacgtgcgcgatattgtctcgcaggtccacgag
gagggcgacgtggcgctccggcgcttcgccgaagaattcgacgatgtgtcggtgggcaac
atcgacatcaccgacgccgcagagcgagcctacgaggaaattgacgacgacgtgcgcgag
gcaatcgaggacgccgcggcgaacatccgcgcgttccacgagcgacaggtccccgaggac
tggcgcgacgacttcgaggggcgtgaactgggccgccgattccgcccgctcgacagcgct
ggggtgtacgcccccggtggcacggcggcctacccctccagcgcgctgatgggcgtcatc
ccggcgaaggtcgctggcgtcgaacacgtcgccgtcgccaccccgccagccgaggaggtc
aaccccgtaacgctggccgccatccacgtcgccggtgctgacgccgtctatcaggtcggc
ggcgcacaggccattgcggcgctggcctacgggaccgagaccgtgagcgcgacggatatc
gtcgtcggccccggcaaccgctgggtcacagcagcgaaggccgaggtccgtggcgacgtg
gcaatcgacttcttggccggcccctccgaagttatggtcgtcgccgacggcgacgcggac
ccggaactggtcgcggcagacctcatcgcacaggccgaacacgacgagaacgcctctgtc
gtcgccgtcaccgacgacgcggacctcgccgagcaggtcgtcgatgccgttgacgagcag
gctgacggccgggagcgcgaggcagtcatccgcgccgcactggacaacgacacatctggc
gtcctcctcgctcgttcgatgagcgaagccgtcctcttcgccgaggagtacgccgccgaa
cacctctcgattcaggccgctgacgacgaatcgctcctcgaacggattccctccgccggg
tccgtgttcctcggcccgtacagccccgttgcagccggcgactacgcgaccgggacgaac
cacgtcttgccgaccggcggcaacgcgcgggtcaccggcggtctctccgtagacacgttc
gtccggtcgacgacagtccagcgcctctccgaggattcgctgggcgacatcgcggacacg
attacgactctcgccgaagccgaagggctggacgcccacgctgagagcgtccgcaaacgg
ttcgagtag

DBGET integrated database retrieval system