KEGG   Haloarcula marismortui: rrnAC0273Help
Entry
rrnAC0273         CDS       T00211                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hma  Haloarcula marismortui
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hma00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:hma00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hma02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:245359..247584
Genome map
AA seq 741 aa AA seqDB search
MRPTDLPEIDTTAQNRRTFMQRTGGVSLAAVLGLSKGASAMVDDDGNFESDPYTLGIASG
DPLPDSVIIWTRLAPNPLEADGAMPSETFSVEWTVATDEGMSDIVNTGTATAEPDHAHTI
HVDADGLEPATEYYYQFACRGETSPIGRTKTAPAAGASVDAFQFGFASCNRWVDGHYTAF
GQMAEDELDLIVHLGDYIYEYGIDVSESPREKSLPQEYKKETTDLDTYRLRYGLYKSDPN
LRAAHASAPWLVTRDDHEVDNNWAGNVPQDPDKQSTEAFIQRRAAALKAYYEHLPFRMEQ
KPDDASQKLYRYYEFGDLLDFNVLDTRLYRSDQACDDVFNKVDCAERFEEDRTILGDAQE
EWLLENLSATETTWNVLANQLPFATMDFKQGPEEGFRTEQWDGYVPEQNLVKTAFEEDAN
NPVVITGDFHSHWANTLISAKDGSSEPVGAEFVGTSISSGGNGTDMDDFGRYVVTENDNV
EYYNNQRGYVRCTVTPDNWTTEFQVLEYVDEPGAPMRTDATVELTAGQPGIPDDNPLILA
DSIAVGNGKNGTAELTGRWLETGLSGAAMTVTISDPEIATITGVSVADPFSISETDVASD
GASADIRFADVEKNAQSVVGGTDTRLATLDIRGQSAGTADIEVSVERLDDDSGTALVANT
ELGVIIVGPPPVTGSDEPTDPDGDGHFEDVNGNGRVDYDDIQLLFDNFDDDSVALNKTAY
DFNENGKLEYDDIVTLYSEVN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctacggacctccctgaaatagacacaacagcacagaaccggcgaacgttcatg
cagcgaactggcggcgtttcgctggcggctgtgctcggactgtctaaaggcgccagtgcg
atggtggacgacgacggcaacttcgaatcggacccgtacacgttagggatcgcatccggt
gacccgctccctgactctgtcatcatctggacgcggctcgccccgaaccccctcgaagcg
gacggtgcgatgcccagtgagacattcagcgtcgagtggacggtcgccactgacgaaggg
atgagcgatatcgttaacaccgggaccgcgactgccgaaccggaccacgcgcacactatc
cacgtcgacgcagacgggcttgaacccgctaccgagtactactaccagtttgcgtgccgc
ggtgagacgagtccgattggccggaccaagaccgcgcccgccgccggcgcgtccgtcgac
gcgtttcagttcggctttgcttcatgtaaccgctgggtcgatggccactacacagcattt
gggcagatggctgaagacgagcttgacctcatcgtccatctgggagactacatctacgag
tacggcatcgatgtttcagaatcaccgcgcgaaaagtcgctcccacaggaatacaagaag
gagacgacggatcttgacacctaccgactccgttacggcctctacaaatcagacccgaat
ctgcgagccgctcacgccagcgccccgtggctcgttactcgcgacgaccatgaggtcgac
aataactgggcagggaacgttccgcaggaccccgacaagcaatctactgaggcgtttata
cagcgccgcgcggcggcattgaaagcgtactacgagcatctgccgttccggatggagcaa
aagcccgacgacgccagccagaagctctacaggtactacgagttcggtgacctgctcgat
ttcaacgtcctcgatacgcggctctatcggtccgaccaggcctgtgatgacgtgttcaat
aaggtcgactgtgcggagcgcttcgaggaggaccgaaccatcctcggggacgcacaggag
gagtggttgcttgagaatctttcggccactgagacgacgtggaacgtgctggcgaaccag
cttcccttcgcgacgatggacttcaagcaggggccagaagaagggttccggacagagcag
tgggacggctacgtccccgagcagaatctggtcaaaactgcgtttgaggaggacgccaac
aacccggtggtcatcaccggtgatttccactctcactgggcgaatacgcttatcagtgcc
aaagacggctccagtgaaccagttggcgcggagttcgtcgggacatcaatctcgtcgggc
gggaacggcaccgacatggacgacttcggtcgctacgtcgtcacagagaacgacaacgta
gagtactacaacaatcagcgcggctacgtccgctgtacggtcacgcctgacaactggacg
acggagtttcaggtcttagagtacgtcgacgaacccggtgcgccgatgcgaacggatgca
acagttgaactcaccgcaggccagcccggcatccccgatgacaacccgttgatcctcgcc
gactctatcgccgtcggcaacggcaagaacgggacggcagaactgaccggccgctggctg
gagacaggactctcaggcgcagcgatgactgtcactatttctgaccccgaaatcgcaacg
ataacaggtgtgtcagtcgctgacccattcagtatctccgagacggacgttgccagtgat
ggagcgtccgccgatatccggtttgccgatgtggaaaagaacgcccagtcagttgtcggt
ggcactgacacccgacttgccacgctcgacatccgtggacagagcgccggaacggctgac
atcgaagtgtcggtcgagaggcttgatgacgacagtggtactgcgctcgtagcgaacacg
gaactgggtgtcatcatcgtcggcccgccgccggtcaccgggagcgacgagccgaccgac
cccgacggcgacggccacttcgaggatgtcaacggcaacgggcgggtagactacgatgac
atccagctgttgttcgacaatttcgacgatgacagcgtcgcgctcaacaagacggcctac
gacttcaacgagaacggcaagctcgaatacgacgatatcgttacgctgtacagcgaggtc
aactga

DBGET integrated database retrieval system