KEGG   Haloarcula marismortui: rrnAC0273Help
Entry
rrnAC0273         CDS       T00211                                 

Gene name
phoD
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hma  Haloarcula marismortui
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    rrnAC0273 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    rrnAC0273 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    rrnAC0273 (phoD)
Enzymes [BR:hma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     rrnAC0273 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:245359..247584
Genome map
AA seq 741 aa AA seqDB search
MRPTDLPEIDTTAQNRRTFMQRTGGVSLAAVLGLSKGASAMVDDDGNFESDPYTLGIASG
DPLPDSVIIWTRLAPNPLEADGAMPSETFSVEWTVATDEGMSDIVNTGTATAEPDHAHTI
HVDADGLEPATEYYYQFACRGETSPIGRTKTAPAAGASVDAFQFGFASCNRWVDGHYTAF
GQMAEDELDLIVHLGDYIYEYGIDVSESPREKSLPQEYKKETTDLDTYRLRYGLYKSDPN
LRAAHASAPWLVTRDDHEVDNNWAGNVPQDPDKQSTEAFIQRRAAALKAYYEHLPFRMEQ
KPDDASQKLYRYYEFGDLLDFNVLDTRLYRSDQACDDVFNKVDCAERFEEDRTILGDAQE
EWLLENLSATETTWNVLANQLPFATMDFKQGPEEGFRTEQWDGYVPEQNLVKTAFEEDAN
NPVVITGDFHSHWANTLISAKDGSSEPVGAEFVGTSISSGGNGTDMDDFGRYVVTENDNV
EYYNNQRGYVRCTVTPDNWTTEFQVLEYVDEPGAPMRTDATVELTAGQPGIPDDNPLILA
DSIAVGNGKNGTAELTGRWLETGLSGAAMTVTISDPEIATITGVSVADPFSISETDVASD
GASADIRFADVEKNAQSVVGGTDTRLATLDIRGQSAGTADIEVSVERLDDDSGTALVANT
ELGVIIVGPPPVTGSDEPTDPDGDGHFEDVNGNGRVDYDDIQLLFDNFDDDSVALNKTAY
DFNENGKLEYDDIVTLYSEVN
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctacggacctccctgaaatagacacaacagcacagaaccggcgaacgttcatg
cagcgaactggcggcgtttcgctggcggctgtgctcggactgtctaaaggcgccagtgcg
atggtggacgacgacggcaacttcgaatcggacccgtacacgttagggatcgcatccggt
gacccgctccctgactctgtcatcatctggacgcggctcgccccgaaccccctcgaagcg
gacggtgcgatgcccagtgagacattcagcgtcgagtggacggtcgccactgacgaaggg
atgagcgatatcgttaacaccgggaccgcgactgccgaaccggaccacgcgcacactatc
cacgtcgacgcagacgggcttgaacccgctaccgagtactactaccagtttgcgtgccgc
ggtgagacgagtccgattggccggaccaagaccgcgcccgccgccggcgcgtccgtcgac
gcgtttcagttcggctttgcttcatgtaaccgctgggtcgatggccactacacagcattt
gggcagatggctgaagacgagcttgacctcatcgtccatctgggagactacatctacgag
tacggcatcgatgtttcagaatcaccgcgcgaaaagtcgctcccacaggaatacaagaag
gagacgacggatcttgacacctaccgactccgttacggcctctacaaatcagacccgaat
ctgcgagccgctcacgccagcgccccgtggctcgttactcgcgacgaccatgaggtcgac
aataactgggcagggaacgttccgcaggaccccgacaagcaatctactgaggcgtttata
cagcgccgcgcggcggcattgaaagcgtactacgagcatctgccgttccggatggagcaa
aagcccgacgacgccagccagaagctctacaggtactacgagttcggtgacctgctcgat
ttcaacgtcctcgatacgcggctctatcggtccgaccaggcctgtgatgacgtgttcaat
aaggtcgactgtgcggagcgcttcgaggaggaccgaaccatcctcggggacgcacaggag
gagtggttgcttgagaatctttcggccactgagacgacgtggaacgtgctggcgaaccag
cttcccttcgcgacgatggacttcaagcaggggccagaagaagggttccggacagagcag
tgggacggctacgtccccgagcagaatctggtcaaaactgcgtttgaggaggacgccaac
aacccggtggtcatcaccggtgatttccactctcactgggcgaatacgcttatcagtgcc
aaagacggctccagtgaaccagttggcgcggagttcgtcgggacatcaatctcgtcgggc
gggaacggcaccgacatggacgacttcggtcgctacgtcgtcacagagaacgacaacgta
gagtactacaacaatcagcgcggctacgtccgctgtacggtcacgcctgacaactggacg
acggagtttcaggtcttagagtacgtcgacgaacccggtgcgccgatgcgaacggatgca
acagttgaactcaccgcaggccagcccggcatccccgatgacaacccgttgatcctcgcc
gactctatcgccgtcggcaacggcaagaacgggacggcagaactgaccggccgctggctg
gagacaggactctcaggcgcagcgatgactgtcactatttctgaccccgaaatcgcaacg
ataacaggtgtgtcagtcgctgacccattcagtatctccgagacggacgttgccagtgat
ggagcgtccgccgatatccggtttgccgatgtggaaaagaacgcccagtcagttgtcggt
ggcactgacacccgacttgccacgctcgacatccgtggacagagcgccggaacggctgac
atcgaagtgtcggtcgagaggcttgatgacgacagtggtactgcgctcgtagcgaacacg
gaactgggtgtcatcatcgtcggcccgccgccggtcaccgggagcgacgagccgaccgac
cccgacggcgacggccacttcgaggatgtcaacggcaacgggcgggtagactacgatgac
atccagctgttgttcgacaatttcgacgatgacagcgtcgcgctcaacaagacggcctac
gacttcaacgagaacggcaagctcgaatacgacgatatcgttacgctgtacagcgaggtc
aactga

DBGET integrated database retrieval system