KEGG   Haloarcula marismortui: rrnAC0383Help
Entry
rrnAC0383         CDS       T00211                                 

Gene name
arg2
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hma  Haloarcula marismortui
Pathway
hma00220  Arginine biosynthesis
hma00330  Arginine and proline metabolism
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01130  Biosynthesis of antibiotics
hma01230  Biosynthesis of amino acids
Module
hma_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    rrnAC0383 (arg2)
   00330 Arginine and proline metabolism
    rrnAC0383 (arg2)
Enzymes [BR:hma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     rrnAC0383 (arg2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAV45425
UniProt: Q5V4X7
Position
I:complement(338707..339654)
Genome map
AA seq 315 aa AA seqDB search
MSLQSTQSRDRSRPTSPVAVLGVPFALGADRRGVDMGPSAIRYGGLSAALDTAGVDYTDA
GDLSPPTLQSQPASADASAKYLDAIAEMTDTLADRVATEIADGSVPLVLGGDHSIAMGTM
RGAAQASELGVIWFDAHGDYNTPTTSPSGNVHGMPLAAAHGYGDFAEMPWATAPNVAEEN
TVIVGARSLDADERAVLRESDISVFTMADIDKQGIGSVTDEALDIATDGVDDIHVSLDLD
WLDPDDAPGVGTPVPGGVTYREAHTAMERVADRDAAESVLRSLDVVEVNPILDQRNTTGE
RAAELAASAFGKRIL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcagtcaacccagtcgcgagaccgcagtcgtcccacgtcacctgtcgcggtg
ctcggtgtcccgttcgccctcggtgccgaccgacgcggcgtcgacatgggtccgtcagcg
attcgctacggcggcctcagcgccgcgctcgatacggccggcgtcgactacactgacgcg
ggggacctttcaccgccgacgctacagtcccaaccggcgtccgccgacgccagtgcgaag
tacctcgatgctatcgcggagatgaccgacacgcttgctgaccgggtggcgaccgaaata
gccgacgggagcgtgccgctggtgttaggcggtgaccactctatcgcaatgggcacgatg
cgcggtgcggctcaggcgtccgaactcggcgtcatctggttcgacgcgcacggggattac
aacaccccgaccacctcgcccagcggcaacgtccacgggatgccgcttgcggccgctcac
ggctacggcgatttcgcagagatgccgtgggccaccgccccgaatgtcgccgaggagaac
actgtcatcgtcggcgcacggagtctggatgctgacgaacgagcggtcctccgcgagagc
gacatctccgtctttacgatggcggacatcgacaagcagggtatcggctcagtcaccgat
gaggcacttgatatcgcgactgacggggtcgatgacatccacgtgagcctcgacctcgat
tggcttgacccggatgacgcgccgggcgttgggacgccggtcccgggtggcgtcacctac
cgggaggcacatacggcgatggaacgggtcgccgaccgcgacgccgccgaatcagtgctg
cgctcgctcgatgtcgtcgaagtcaaccccatcctcgaccagcgcaacacgacgggcgag
cgagcggccgaactcgccgccagcgcattcggcaagcggatcctgtag

DBGET integrated database retrieval system