KEGG   Haloarcula marismortui: rrnAC0453Help
Entry
rrnAC0453         CDS       T00211                                 

Gene name
arg1
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hma  Haloarcula marismortui
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    rrnAC0453 (arg1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    rrnAC0453 (arg1)
Enzymes [BR:hma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     rrnAC0453 (arg1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:399416..400330
Genome map
AA seq 304 aa AA seqDB search
MQEQVRVLGVPMDLGADRRGVDMGPSAIRYGGLADQLSDIGIDCIDGGDIAVPRPEERDP
DAGGLDSGRAKFFRETKEVCEDVTTAVDATLREGRFPLVLGGDHSIGIGTVAGAAREDEE
LGVIWFDAHGDFNTPATTPSGNIHGMSLAAVLGLGAFSDHAWAHTPAVSEENVVIVGLRD
VDDGERRLIEESDITAYTMSDIDARSAPAVVDEALDIATDGTDGIHVSLDLDWLDPTEAP
GVGTPVRGGVSYREAHIAMEYVAEQHDQLRSMELVEVNPILDEHNRTAELACELVASAFG
KRVL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacaggttcgtgttctcggcgtgccgatggacctcggcgctgaccggcgcggc
gtcgacatgggaccgtcagcaatacggtacggcggcctcgccgaccagttgtcggatatt
ggtatcgactgcatcgacggcggcgacatcgctgtgccgcgaccggaggagcgcgacccc
gatgccggtggtctggacagtgggcgcgcgaagttcttcagagagacaaaagaggtctgt
gaggacgtgacgacggcggtcgacgcgaccctccgggagggacggttcccgctcgttctg
ggtggcgaccactctatcggcattggaaccgtcgccggtgcagcccgcgaggacgaagag
ctgggcgtcatctggttcgacgcgcacggcgatttcaacacgccggcgacgacacccagc
gggaacatccacgggatgtcgctggcggctgtcctcggtctcggtgcgttctccgaccat
gcgtgggcgcacacaccagcggtaagcgaagaaaacgtcgtcatcgttgggctgcgagac
gtggacgacggggaacgccggctgatcgaagaaagcgatatcacggcatacacgatgtcg
gatatcgacgcccggagcgcgccggcagtcgtcgatgaggcgctggatatcgcaacagac
gggacggacgggatacacgtctcgctcgacctcgactggctcgacccgacggaggccccc
ggcgtcgggacaccggttcgtggcggcgtctcctaccgcgaggcccacatcgcaatggag
tacgtcgccgaacagcacgaccagctgcgctctatggaactggtcgaagtgaacccgatt
ctcgacgaacacaaccgcactgccgaactggcctgtgaactcgtcgccagtgccttcggc
aagcgcgtactgtaa

DBGET integrated database retrieval system