KEGG   Haloarcula marismortui: rrnAC0457Help
Entry
rrnAC0457         CDS       T00211                                 

Gene name
top6B
Definition
DNA topoisomerase VI subunit B (EC:5.99.1.3)
Orthology
K03167  
DNA topoisomerase VI subunit B [EC:5.99.1.3]
Organism
hma  Haloarcula marismortui
Brite
Enzymes [BR:hma01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     rrnAC0457 (top6B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:405058..407448
Genome map
AA seq 796 aa AA seqDB search
MTSYQSQLGEGEGIAEELAESQRAISIAEFFEKNKHMLGFDSEARALVTAVKEAVDNALD
ACEEAGILPDIYVEIQESGDYYKLVVEDNGPGITKEQAPKIFGKLLYGSRFHAREQNRGQ
QGIGISAAVLYSQLTSGKPAKITSRPKGQDEAQYFELIVDTDTNEPEISVDETTTWERPH
GTRIELEMEANMRARSTLRDYIQDTAVVNPHARVEFDEPGLDESLKFERAERAELPDETE
EIRPHPHGVELGTLLKMLEATDSYSVSGFMQEEFTRVGGKTADSVIANFNDRHYGRGMAW
QPPKVNEDADIERAVEDAVANKGAETTATFAAAVSDAIHDRDRVAYHEVESIVDSAAEDA
EADGDTTFGATVRENAVDAAWNAVSDNLSSDLYALVDDVTTKRKDDAAVEGLASRLADKF
DDDGRHRLTRDELRGYIDRAADMTEEQDDATFGETARENVLEALWTAAEGVREEPPKVSD
IADDRDTASQLLSAMRETDIIAPPTDCLSPISAELVEEGLRKEFDADFYAASTRDASVHG
GDPFIVEAGIAYGGELESEGTVDVMRFANRVPLVYQRGACATTDVVKSIRWRNYNLDQPG
GSGIPKGPAVIMVHVASTNVPFTSESKDAIANVPEMEDEIELAIREAARELKSYLNKRRS
MQQRREKQDKLATILPEMAEKLTEVTDNDELHIDDSLARIMNNVLVEREVEDDTVRVRIE
NNDDTNADVELTDIVTAEPQVTNGATVVEMDGEWFVKWSPTVGAGETAVLEYSVTDEAEF
TVSVDGIEEEKLTVNA
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtatcagtcgcaactcggcgagggcgaggggatcgccgaggagttggccgaa
tcccagcgggccatctccatcgccgagttcttcgagaagaacaagcatatgctgggcttc
gactcggaggcccgggcgctcgttacggccgtcaaagaagccgtcgacaacgcgctcgac
gcctgcgaggaagccggtattctccccgatatctacgtcgagattcaggagtccggggac
tactacaagctggtcgttgaggacaacggccccgggattacgaaggaacaagcgccgaag
atcttcgggaagctcctctacgggtcccgattccacgccagagagcaaaaccgcggccag
caggggatcggtatctccgcggccgtgctctactcacagctgacttccggcaagcccgca
aaaataacgtcccggccgaaggggcaggacgaggcgcagtacttcgaactcatcgtcgac
acggacactaacgaacccgagattagcgtcgacgagacaacgacgtgggagcgaccccac
gggacgcgaatcgaactggagatggaggccaacatgcgagcccggtcgacgctgcgggac
tacattcaggacaccgctgttgtcaaccctcacgcccgcgtcgagttcgacgaaccgggg
ctggacgagtccctgaagttcgagcgggccgagcgcgcggagctccccgacgagaccgaa
gagatccgcccgcacccccacggcgtcgagttggggacgctcctgaagatgctcgaagcg
acagattcgtactccgtatccggcttcatgcaggaggagttcacccgcgtcggcgggaag
accgccgacagcgtcatcgcgaacttcaacgaccggcactacggccgcggcatggcctgg
cagccgccgaaagtcaacgaggacgccgatatcgagcgcgctgtcgaggacgccgtggcg
aacaagggcgctgaaaccactgcgacgttcgcagccgccgtctccgatgctatccacgac
cgcgaccgggtcgcgtaccacgaggtcgaatccatcgtcgattcggcggccgaagacgcc
gaagcggacggcgacacgacgttcggcgcgacagttcgagaaaacgccgtcgacgcggcc
tggaacgccgtcagcgacaacttgtcgagtgacctctacgccctcgtcgacgacgtgacg
acgaaacgcaaggacgacgccgcagtcgaggggctggcgagccgactggccgacaagttc
gacgacgacggccgccaccggctgacccgcgacgaactccggggctacatcgaccgcgcg
gccgacatgaccgaggagcaagacgacgccaccttcggcgagacggcccgtgagaacgtg
ctagaggcgctctggacggccgcagagggcgtccgggaggagccgccgaaggtctccgac
atcgccgacgaccgcgatacggcgagtcagttgctgtcggcgatgcgcgagacggacatc
atcgcgccgccgacggactgtctctcccccatcagcgcggaactcgtcgaggaaggactc
cggaaagagttcgatgcggacttctacgccgcgtcgacgcgagacgcgtcggtccacggc
ggcgacccgttcatcgtcgaggccggtatcgcctacggcggtgaactcgaaagcgagggg
acagtcgacgtgatgcgattcgccaaccgggtcccgctggtgtaccagcgcggggcctgt
gcgacgactgacgttgtgaagtccatccgctggcgcaactacaacctcgaccagcccggc
ggctcgggcatcccgaaggggccggccgtcatcatggtccacgtcgcctcgacgaacgtg
cccttcaccagcgagtcaaaggacgccatcgccaacgtccccgagatggaagacgaaatc
gaactcgccatccgggaggctgctcgcgaactcaagagctacctgaacaagcgtcgctcg
atgcaacagcgccgcgagaagcaggacaagctggcgactatcctgcccgagatggccgaa
aagctcaccgaagtcacggacaacgacgagctacacattgatgactcgctggcccgcatc
atgaacaacgtcctcgtcgagcgcgaggtcgaggacgacacggtccgggtccgtatcgag
aacaacgacgacacgaacgcggacgtggaactgaccgacatcgtcaccgccgaaccgcag
gtcaccaacggcgcgacggtcgtcgagatggacggcgagtggttcgtcaagtggtccccg
actgtcggggccggtgaaaccgccgtcctcgaatacagcgtgaccgacgaggccgagttc
accgtctcggtcgacggcatcgaagaggagaaactcacggtgaacgcctga

DBGET integrated database retrieval system