KEGG   Haloarcula marismortui: rrnAC0472Help
Entry
rrnAC0472         CDS       T00211                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hma  Haloarcula marismortui
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC0472 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    rrnAC0472 (sucC)
   00640 Propanoate metabolism
    rrnAC0472 (sucC)
   00660 C5-Branched dibasic acid metabolism
    rrnAC0472 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnAC0472 (sucC)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     rrnAC0472 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:419417..420565
Genome map
AA seq 382 aa AA seqDB search
MRLHEYQAKQVFADAGIPTPASQLAETVDEAVDAAEEIGYPVAIKAQVHVGGRGKAGGIK
LVESKEEAREAAEDIIGMDLKGYHVSKVLVEEAVDFVNELYVGVTMDRGEGRPVAMVSTK
GGVNIEEVAEEDPDAIAREHIDPAFGMHPFQARKVVYEAGVDREVANDVASVLTTLYQLW
DDRDGADTEINPLMITSDDEVIAADAVMNVDGDALFRQPEIAEMGEEAAEGDELEQKADE
YGFDYVRLDGNVGIIGNGAGLVMTTLDLVDYYDGEPANFLDVGGGAKADRIANALDMVFS
DENVDSVVFNIFGGITRGDEVANGINQALEQFDEIPKPVTVRLAGTNAEEGMEILNEDLV
TVEHTLEDAVQRAVEYAKEVEA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcacgaataccaggcgaagcaagtcttcgctgacgcgggcatcccgacgccc
gcctcgcagctggccgagacagtagatgaggccgtcgacgcggccgaggaaatcggatat
ccggtcgccatcaaagcacaggtccacgtgggcggccgcggtaaggccggcggcatcaaa
ctcgtcgagtccaaggaggaggcccgcgaggccgccgaggacatcatcgggatggacctc
aagggctaccacgtctcgaaggtgcttgtcgaggaagccgtcgacttcgtcaacgagctg
tacgtcggcgtgacgatggaccgcggcgagggccgccccgtcgcaatggtgtccaccaaa
ggcggcgtcaacatcgaggaggtcgccgaggaggaccccgacgccatcgcccgcgagcac
atcgacccggccttcgggatgcacccgttccaggcccggaaagtcgtctacgaggccggt
gtcgaccgcgaggtcgcaaacgacgtggcgagcgtcctcacgacgctgtaccagctctgg
gacgaccgcgacggcgctgacacggaaatcaatccgctgatgattaccagcgatgacgag
gtcatcgcggccgacgccgtcatgaacgtcgacggtgacgccctgttccgccagcccgaa
atcgcggagatgggcgaggaagcggcggaaggcgatgaactcgaacagaaggccgacgag
tacggcttcgattacgtccgactcgacggcaacgtcggcatcatcggtaacggtgcgggc
ctcgtgatgacgacgctggacctcgttgattactacgacggcgagcccgccaacttcctc
gatgtcggtggcggcgcgaaggccgaccgtatcgcaaacgcgctcgatatggtgttctcc
gacgagaatgttgattcggtcgtgttcaacatcttcggcggtatcacccgtggtgacgag
gtcgccaacggcatcaatcaggcgctggagcagttcgacgagatcccgaagccggtcacc
gtccgactcgcagggaccaacgcagaggaggggatggaaatcctgaacgaggatctggtg
acggtcgagcacacgctggaggacgccgtccagcgtgcggttgagtacgcaaaggaggtg
gaagcatga

DBGET integrated database retrieval system