KEGG   Haloarcula marismortui: rrnAC0472Help
Entry
rrnAC0472         CDS       T00211                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hma  Haloarcula marismortui
Pathway
hma00020  Citrate cycle (TCA cycle)
hma00640  Propanoate metabolism
hma00660  C5-Branched dibasic acid metabolism
hma00720  Carbon fixation pathways in prokaryotes
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
Module
hma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    rrnAC0472 (sucC)
   00640 Propanoate metabolism
    rrnAC0472 (sucC)
   00660 C5-Branched dibasic acid metabolism
    rrnAC0472 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnAC0472 (sucC)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     rrnAC0472 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 Ligase_CoA ATP-grasp GARS_A Dala_Dala_lig_C RimK DUF4891
Motif
Other DBs
NCBI-ProteinID: AAV45498
UniProt: Q5V4Q4
Position
I:419417..420565
Genome map
AA seq 382 aa AA seqDB search
MRLHEYQAKQVFADAGIPTPASQLAETVDEAVDAAEEIGYPVAIKAQVHVGGRGKAGGIK
LVESKEEAREAAEDIIGMDLKGYHVSKVLVEEAVDFVNELYVGVTMDRGEGRPVAMVSTK
GGVNIEEVAEEDPDAIAREHIDPAFGMHPFQARKVVYEAGVDREVANDVASVLTTLYQLW
DDRDGADTEINPLMITSDDEVIAADAVMNVDGDALFRQPEIAEMGEEAAEGDELEQKADE
YGFDYVRLDGNVGIIGNGAGLVMTTLDLVDYYDGEPANFLDVGGGAKADRIANALDMVFS
DENVDSVVFNIFGGITRGDEVANGINQALEQFDEIPKPVTVRLAGTNAEEGMEILNEDLV
TVEHTLEDAVQRAVEYAKEVEA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcacgaataccaggcgaagcaagtcttcgctgacgcgggcatcccgacgccc
gcctcgcagctggccgagacagtagatgaggccgtcgacgcggccgaggaaatcggatat
ccggtcgccatcaaagcacaggtccacgtgggcggccgcggtaaggccggcggcatcaaa
ctcgtcgagtccaaggaggaggcccgcgaggccgccgaggacatcatcgggatggacctc
aagggctaccacgtctcgaaggtgcttgtcgaggaagccgtcgacttcgtcaacgagctg
tacgtcggcgtgacgatggaccgcggcgagggccgccccgtcgcaatggtgtccaccaaa
ggcggcgtcaacatcgaggaggtcgccgaggaggaccccgacgccatcgcccgcgagcac
atcgacccggccttcgggatgcacccgttccaggcccggaaagtcgtctacgaggccggt
gtcgaccgcgaggtcgcaaacgacgtggcgagcgtcctcacgacgctgtaccagctctgg
gacgaccgcgacggcgctgacacggaaatcaatccgctgatgattaccagcgatgacgag
gtcatcgcggccgacgccgtcatgaacgtcgacggtgacgccctgttccgccagcccgaa
atcgcggagatgggcgaggaagcggcggaaggcgatgaactcgaacagaaggccgacgag
tacggcttcgattacgtccgactcgacggcaacgtcggcatcatcggtaacggtgcgggc
ctcgtgatgacgacgctggacctcgttgattactacgacggcgagcccgccaacttcctc
gatgtcggtggcggcgcgaaggccgaccgtatcgcaaacgcgctcgatatggtgttctcc
gacgagaatgttgattcggtcgtgttcaacatcttcggcggtatcacccgtggtgacgag
gtcgccaacggcatcaatcaggcgctggagcagttcgacgagatcccgaagccggtcacc
gtccgactcgcagggaccaacgcagaggaggggatggaaatcctgaacgaggatctggtg
acggtcgagcacacgctggaggacgccgtccagcgtgcggttgagtacgcaaaggaggtg
gaagcatga

DBGET integrated database retrieval system