KEGG   Haloarcula marismortui: rrnAC0537Help
Entry
rrnAC0537         CDS       T00211                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC0537 (tpiA)
   01230 Biosynthesis of amino acids
    rrnAC0537 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC0537 (tpiA)
   00051 Fructose and mannose metabolism
    rrnAC0537 (tpiA)
   00562 Inositol phosphate metabolism
    rrnAC0537 (tpiA)
Enzymes [BR:hma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     rrnAC0537 (tpiA)
Exosome [BR:hma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   rrnAC0537 (tpiA)
  Exosomal proteins of bladder cancer cells
   rrnAC0537 (tpiA)
  Exosomal proteins of melanoma cells
   rrnAC0537 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:470253..470900
Genome map
AA seq 215 aa AA seqDB search
MFVLVNLKAYPCDPVEVATAAADVSDDSGVRVAVAPQAAQISAVAETGVETWAQHVSAVE
HGSHTGSTLAEAAADAGAVGTLLNHSENRLKLADIDGALDAADRADLETIVCANNPAQIG
AAAALDPDGVAVEPPELIGTGTPVSKADPDIVTGAVDAAARVNGDVDVLCGAGISTGEDL
VSASDLGASGVLLASGVAKADDPRAALEDLVEPLL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccttgtcaatctgaaggcgtacccgtgtgacccagtcgaggtagcaaccgct
gctgctgacgtcagcgacgattccggcgttcgcgttgccgtcgcgccacaggctgcccag
atcagcgctgtggcggagaccggcgtcgaaacgtgggctcagcacgtcagcgccgtcgag
cacggcagccacaccggcagcaccctcgccgaggccgctgcagacgccggtgccgtcggg
acgctgctgaaccactccgaaaaccggctcaagctcgcggacatcgatggggcactcgac
gccgccgaccgcgcggacctcgaaacgatcgtctgtgcgaacaaccccgcacagatcggc
gcggccgccgcgctcgaccccgacggtgtggccgtcgagccaccggaactcatcgggact
ggcacgcccgtcagcaaggcagacccagatatcgtgaccggcgcagtcgatgctgccgct
cgcgttaacggtgacgtggacgtgctctgtggggccggcatctcgaccggcgaagacctc
gtctcggcgagcgacctcggcgcgagcggcgtcctactggcaagcggcgttgcgaaggct
gacgacccgcgcgccgcactcgaagacctcgtcgaaccgctgctgtaa

DBGET integrated database retrieval system