KEGG   Haloarcula marismortui: rrnAC0545Help
Entry
rrnAC0545         CDS       T00211                                 

Gene name
pfk1
Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00874  
2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]
Organism
hma  Haloarcula marismortui
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:hma01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hma00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:478474..479433
Genome map
AA seq 319 aa AA seqDB search
MTELVTFGETMLRLSPPGDERLETADQYAVRAAGAESNVAVAAQRLGVDAMWASKLPDSP
VGRRVTGELKHHGVSVDVAWDDSDSARQGTYYLEQGSPPRGNDVIYDRQNASVTTATPAE
LPTEAIADAAGFHTSGITPALSETLESTTADLLSLAQDAGTTTSFDLNYRSKLWTPAEAR
SVLTELFPSVDLLVVAERDANVVLDRTGDAETIARDLAAEYGFEATVITRGSDGALALAD
GTVTEQPTFESTDAHPVGTGDSFVGGFLSQYLSGGTVADGLAWGAATAALKRTIPGDIAV
VSPDEIRSILSGDTEAISR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacggagttagttacgttcggtgagacgatgttgcggttatcgccacctggcgacgag
cgactggagactgcagaccagtacgccgtcagggcggctggcgcggagtcgaacgtcgca
gttgctgcgcaacggcttggagtcgacgcgatgtgggcgtcgaaactccccgattcaccg
gtcggtcgccgagtcacgggtgaactcaagcaccacggcgtgtcggtcgatgttgcctgg
gacgactccgacagcgcccgacagggaacatactatctagaacagggcagcccaccacgg
ggcaacgacgttatttacgatcgccaaaacgccagtgtcacaaccgccacaccagctgag
cttcccacggaggccatcgcagacgccgcggggttccatacctcggggatcacaccggcg
ctctcggagacgctcgaatcgaccactgctgacctcctttcgctcgcacaagacgcgggc
acgacgacgagcttcgacctgaactaccgctcgaagctctggacgccggcggaagcccgt
tcagttctgacagagctattcccgtctgtcgacctgctcgttgttgccgaacgcgatgcg
aacgtcgtgttggaccggaccggcgacgccgaaacgatcgctcgggacctcgccgccgag
tacgggttcgaagcgacagtgatcacccgtggtagcgatggggcgctcgcgcttgctgat
gggactgtaacggagcaaccgacgttcgagtcgaccgatgcgcacccggttgggaccggc
gactcctttgtcggtggtttcctctcgcagtacctctccggtggcaccgttgcagacggg
cttgcttggggtgccgcgacggccgcactcaaacggacgataccaggcgatattgctgtc
gtatcgccagacgaaatccgttctattctcagcggtgatacggaagcgatttcgcggtag

DBGET integrated database retrieval system