KEGG   Haloarcula marismortui: rrnAC0547Help
Entry
rrnAC0547         CDS       T00211                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC0547 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC0547 (glcK)
   00052 Galactose metabolism
    rrnAC0547 (glcK)
   00500 Starch and sucrose metabolism
    rrnAC0547 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    rrnAC0547 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    rrnAC0547 (glcK)
   00524 Butirosin and neomycin biosynthesis
    rrnAC0547 (glcK)
Enzymes [BR:hma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     rrnAC0547 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:481377..482348
Genome map
AA seq 323 aa AA seqDB search
MGAYAGVDLGATHIRAVIGDETGSIVSSHKTETPRGPAGIAVTEAVLDAIRQACDAADIA
PTDVVAAGIGSFGPMDLAEGVVENPANLPDTIDRIPLTGPVENLIGSERVSLHNDANAGV
IGERFYSDRSPDDMVYLTISSGVGAGVAVDGNILSGWDGNAGEVGHLTIDPHGFMTCGCG
HDGHWEAYCSGENIPRYATQLHREDPVETALPIETEEFSAADIFEYAGEDEFASHVLDQI
CHWNAIGVANIVHAYAPLVVYVGGAVALNNPEQVLNPIRERLDDMVMSNIPDIQLTQFGD
DVVVRGALASALTGGTGDPSQRV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcttacgcaggggtcgacctcggagcgacacatattcgcgctgttatcggtgac
gagacgggctcgatagtctcgtcacacaaaactgaaacaccacgtggaccggcgggcatt
gcggtcacggaggcggtcctcgacgcgatccggcaggcctgtgacgccgccgacatcgcc
cccacagacgtggttgccgccggtatcggatccttcggcccgatggatctggccgaaggt
gtcgtcgaaaacccagcgaaccttccagacaccatcgaccggattccgctgactgggccg
gtcgaaaacctcatcggcagcgagcgagtgtcgctacacaacgacgccaacgccggcgtc
atcggcgaacggttctactcggaccggagccccgatgacatggtgtatctcactatctca
tccggagtcggcgctggggtcgccgttgacgggaacatcctgtcaggctgggacggcaac
gccggcgaagtcgggcatctgaccatcgatccgcacggtttcatgacctgtggctgtggg
cacgacggccactgggaggcatattgctcgggcgagaacattccccggtatgccacacaa
ctgcaccgagaggaccccgtcgagacggcgctcccaatcgagactgaggagttttcggcg
gcagatatcttcgagtatgctggtgaagatgagttcgcgtctcacgttctcgaccagatc
tgtcactggaacgctatcggcgtcgcgaacatcgttcacgcgtatgcacctctcgttgtc
tacgtcggtggggccgttgcactcaacaaccccgagcaggtgctaaatccgatccgggag
cggctcgatgacatggtgatgtcgaacattccggatatccagttaacgcagtttggcgac
gatgtcgtggttcgtggtgcactggcgtccgcactgactggcggcacaggcgacccgtca
cagcgcgtttaa

DBGET integrated database retrieval system