KEGG   Haloarcula marismortui: rrnAC0550Help
Entry
rrnAC0550         CDS       T00211                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hma  Haloarcula marismortui
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    rrnAC0550 (glpK)
Enzymes [BR:hma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     rrnAC0550 (glpK)
Exosome [BR:hma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   rrnAC0550 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(484709..486241)
Genome map
AA seq 510 aa AA seqDB search
MADTYVGAIDQGTTGTRFMVFDHSGQVVANAYEKHEQIYPEPGWVEHDPVEIWENTQEVV
TKGLADAGVGAEQLEALGITNQRETTIVWDKETGKPVHNALVWQDRRTTDRVEEIQEEDK
VEWIRGKTGLECDAYFSATKTEWILDNAEPLKMQSSRGADLRERAEDGELLMGTIDAWLI
YKLTGNHITDVSNASRTMLYNIHDMEWDDELLEEFGVPESMVPEVRPSSDESLYGHTDAD
GFLKEEVPVAGALGDQQAALFGQTCFDKGDAKNTYGTGAFYLMNTGSEAVASDNGLLTTV
GFQMSGEPVQYALEGSIFIAGAAIEWLEDVDLINNAAQTAELARSVESTDGVYMVPAFTG
LGAPHWDGRARGTIVGMTRGTRKEHIVRATLESIAYQTRDLAEAMEEDSGVEMTTLRVDG
GAVKNNFLCQLQSDIIQTDIARPQVDETTALGSAYAAGLAVGYWDTVDELRDNWQVDEEF
SPEMDAGKADKMYARWDDAVDRSRDWAQEE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacatacgttggcgcgatcgatcagggaacgaccggtacccgcttcatggtg
ttcgaccacagcggccaggtcgttgcgaatgcctacgagaagcacgaacagatttacccg
gagcccggctgggttgagcacgaccccgtcgaaatctgggaaaacacgcaggaagtcgtg
acgaaggggctggcggatgcaggtgtcggtgccgaacagctcgaagcgcttggcatcacg
aaccagcgtgagacgacgatcgtctgggacaaggagaccggcaaaccggtccacaacgcg
ctggtctggcaggaccgccgaaccaccgaccgcgtcgaggaaattcaggaagaggacaaa
gtcgaatggatccgggggaagaccgggctggaatgtgacgcctacttctcggcgaccaag
accgaatggatcctcgacaacgcggaaccactcaagatgcagagctcgcgcggcgctgac
ctccgtgagcgagccgaagacggtgaactcctgatggggaccatcgacgcgtggctcatc
tacaagctcaccggcaaccacatcacggatgtctcgaacgcatcgcggacgatgctgtac
aacatccacgacatggagtgggacgatgaactcctcgaagagttcggcgttccggagtcc
atggttccggaagtccgcccgtcctccgacgagagtctgtacgggcacaccgacgcggac
ggcttcctcaaagaggaagtccccgttgcgggcgcgctgggcgaccagcaggccgcgctg
ttcggccagacctgcttcgacaagggtgatgcgaagaacacctacggcaccggcgcgttc
tacctgatgaacactggctccgaagcagtcgcctcggataacggcctgctgacgaccgtc
ggcttccagatgtccggtgagcccgtccagtacgcgctggaaggctccatcttcatcgcc
ggcgcggccatcgaatggctcgaggacgtcgacctcatcaacaacgccgcccagacagca
gaactggcccgctcggttgaatcaaccgacggtgtctacatggtgccggccttcacgggt
ctcggcgctccgcactgggacggccgcgcccgcgggacgattgtcggaatgacccgcgga
acgcgaaaagagcacatcgtgcgtgcgaccctggaatccatcgcgtaccagacccgcgac
ctcgcggaagcgatggaggaagactccggtgtcgagatgacgacgctgcgagtcgacggt
ggtgcagtcaagaacaacttcctctgtcagctccagtccgacatcatccagacggacatc
gctcgaccacaggttgacgagaccactgccctcgggtcggcatacgcagccggcctcgcc
gtcgggtactgggacaccgtcgacgaacttcgggacaactggcaggtcgacgaggagttc
tcgccggagatggacgctggaaaggcagacaagatgtacgcccgctgggacgacgccgtc
gaccgttcccgtgactgggcacaggaggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system