KEGG   Haloarcula marismortui: rrnAC0616Help
Entry
rrnAC0616         CDS       T00211                                 

Gene name
pecE
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
hma  Haloarcula marismortui
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    rrnAC0616 (pecE)
   00500 Starch and sucrose metabolism
    rrnAC0616 (pecE)
Enzymes [BR:hma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     rrnAC0616 (pecE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(534032..535162)
Genome map
AA seq 376 aa AA seqDB search
MNTTVYIYSPPTPPTMDDARTTLPALLLSLVLTLAVVPAGVAGTQTAQDTLTVDKDGSAE
YQSIQAAVNAADSGDTVEVRPGTYREEVRINESITLVAPDRAILGGSRFVNGTGVTVAGA
ADANVTGFTVRNYRFGVAANETSGDWTVTDTTVIAADVGVYAPNTAGNWTIEDAAVASTT
YSGVFVRGTSGDWTIRDTRFVNVGGDGVDVRKSSGDWTVATVVVDRSGADGVDASGTTGD
WTVRNTEVRRSNTGVKAIDSGGNWTVTDLTVHRSDTGLVTAFSGGAWTLEDSTLETRDIG
VFTARTTGAWTIQNTTIESQQQGIHAVNTNASWTVSESTISVTAEQNAIGVDARSASGDW
SLTDVTIESPGIEVAE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaacactacagtttacatctattcgccccctacacctccaactatggacgacgcccga
acgacattgcctgccctcttgctgtcgctagtgttgacgctggctgtcgtgccagccggc
gtggccggaacacagacggcgcaggacacactgaccgtcgataaagacgggagtgccgag
taccagtcaatacaggccgctgtgaacgctgccgacagcggtgacaccgtcgaggtccgg
ccgggcacctaccgcgaagaagtccgaatcaacgagagtattaccctcgtcgcacccgac
cgggcgatactgggcggttcgcggttcgtcaacggaaccggcgtcacggtggccggcgca
gccgacgcgaacgtcaccggattcaccgtgcgtaactaccgctttggcgtcgccgccaac
gaaaccagcggtgactggacagtcactgacacgactgttatcgctgccgatgtcggggtc
tacgcgccgaatacggctggaaactggactatcgaggacgccgccgtcgccagcacaacc
tacagcggcgtgttcgtccgcggcaccagcggcgactggacgattcgcgacacccgattc
gtcaatgtcggtggcgacggcgtcgatgtccgcaagtcctccggtgactggacagtcgca
acggttgtcgtcgaccggtccggcgcagacggagtcgacgcctccgggacaactggcgac
tggacggtccggaacacagaggtccgccgaagcaacaccggcgtcaaagccatcgacagt
ggcggcaactggacggtgactgacctgacggtccaccgaagcgataccggcctcgtaacc
gccttctctggaggtgcgtggacacttgaagattctacccttgaaacccgagacatcggt
gtcttcaccgctcgaacgaccggagcatggactatccagaatacgaccattgagagccaa
cagcagggaatccacgccgtcaacacgaacgcgtcatggactgtctccgagtcgactatc
tccgtgaccgcagagcaaaatgccatcggtgtcgacgcccggtccgcgagtggggactgg
tcgcttaccgatgtcaccatcgaaagccccggcatcgaagttgccgagtga

DBGET integrated database retrieval system