KEGG   Haloarcula marismortui: rrnAC0648Help
Entry
rrnAC0648         CDS       T00211                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hma  Haloarcula marismortui
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hma00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hma00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:561275..562144
Genome map
AA seq 289 aa AA seqDB search
MASSTSHERLEVEPIDESSILFADDDHYTSDTVCLVTGGGSGIGRATALAMAANGVTAVA
TDIDADGLAEVADTAADLDLDGAVETVAGDLANDADIEAIVETAASHGTVRYLANIAGLQ
HIDAIEDFPMEKYDQMHDVMLRAPLALSKRVIPHIRGTDDGVGAIGNMASVHGHYVTSDK
VAYNVSKFGLRGLTQSIAAEGGDGLRGFSISTGYVKTPLVVDQIPDTAEQRGISVDEVID
DVMLGQARIKEMMDPIDVANLFVFGFSRHANHLNGGDLLFDGGMTKTYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagcacttctcacgaacggctcgaagtcgagcccatcgacgagtcttcgatc
ctgttcgccgacgacgaccactacacgagcgacaccgtctgtctggtgaccggtggtggg
tcgggcatcggccgggcgacggcgcttgcgatggccgctaacggggtgaccgccgttgcc
acagacatcgacgcggacggcctcgcagaggtcgcggacacggcggcggacctcgacctt
gatggggccgtcgagaccgtggccggcgatcttgcgaacgacgcggacatcgaagctatc
gtcgagaccgcggcttctcacggcaccgtgcgctacctcgccaacatcgccggtctccag
cacatcgacgccatcgaagacttcccgatggagaagtacgaccagatgcacgacgtaatg
cttcgcgccccactcgcgctgtcgaagcgcgtcatcccgcacatccgcggcaccgacgac
ggcgtgggtgccatcgggaacatggcgtcggtccacggccactacgtcacctccgataag
gtggcctacaacgtctcgaagttcggtcttcgggggctgacacagtctatcgccgccgag
ggcggtgacggcctccgtgggttctccattagcacgggctacgtcaagacgccgctggtc
gtcgaccagattcccgacaccgccgagcaacggggcatcagcgtcgacgaggtcattgat
gacgtgatgctgggccaggcccggatcaaggagatgatggaccctatcgacgtggcgaac
ctcttcgtgttcggcttctcgaggcacgccaaccatctcaacggcggggacctgctgttc
gacggcggcatgacaaaaacgtacgagtga

DBGET integrated database retrieval system