KEGG   Haloarcula marismortui: rrnAC0648Help
Entry
rrnAC0648         CDS       T00211                                 

Gene name
bdhA
Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hma  Haloarcula marismortui
Pathway
hma00072  Synthesis and degradation of ketone bodies
hma00650  Butanoate metabolism
hma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    rrnAC0648 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    rrnAC0648 (bdhA)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     rrnAC0648 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_7 HHH_5
Motif
Other DBs
NCBI-ProteinID: AAV45653
UniProt: Q5V499
Position
I:561275..562144
Genome map
AA seq 289 aa AA seqDB search
MASSTSHERLEVEPIDESSILFADDDHYTSDTVCLVTGGGSGIGRATALAMAANGVTAVA
TDIDADGLAEVADTAADLDLDGAVETVAGDLANDADIEAIVETAASHGTVRYLANIAGLQ
HIDAIEDFPMEKYDQMHDVMLRAPLALSKRVIPHIRGTDDGVGAIGNMASVHGHYVTSDK
VAYNVSKFGLRGLTQSIAAEGGDGLRGFSISTGYVKTPLVVDQIPDTAEQRGISVDEVID
DVMLGQARIKEMMDPIDVANLFVFGFSRHANHLNGGDLLFDGGMTKTYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagcacttctcacgaacggctcgaagtcgagcccatcgacgagtcttcgatc
ctgttcgccgacgacgaccactacacgagcgacaccgtctgtctggtgaccggtggtggg
tcgggcatcggccgggcgacggcgcttgcgatggccgctaacggggtgaccgccgttgcc
acagacatcgacgcggacggcctcgcagaggtcgcggacacggcggcggacctcgacctt
gatggggccgtcgagaccgtggccggcgatcttgcgaacgacgcggacatcgaagctatc
gtcgagaccgcggcttctcacggcaccgtgcgctacctcgccaacatcgccggtctccag
cacatcgacgccatcgaagacttcccgatggagaagtacgaccagatgcacgacgtaatg
cttcgcgccccactcgcgctgtcgaagcgcgtcatcccgcacatccgcggcaccgacgac
ggcgtgggtgccatcgggaacatggcgtcggtccacggccactacgtcacctccgataag
gtggcctacaacgtctcgaagttcggtcttcgggggctgacacagtctatcgccgccgag
ggcggtgacggcctccgtgggttctccattagcacgggctacgtcaagacgccgctggtc
gtcgaccagattcccgacaccgccgagcaacggggcatcagcgtcgacgaggtcattgat
gacgtgatgctgggccaggcccggatcaaggagatgatggaccctatcgacgtggcgaac
ctcttcgtgttcggcttctcgaggcacgccaaccatctcaacggcggggacctgctgttc
gacggcggcatgacaaaaacgtacgagtga

DBGET integrated database retrieval system