KEGG   Haloarcula marismortui: rrnAC0799Help
Entry
rrnAC0799         CDS       T00211                                 

Gene name
cdlM
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hma  Haloarcula marismortui
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hma00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(691386..692453)
Genome map
AA seq 355 aa AA seqDB search
MLHMDTRRREFLESLLTTPGPSGYEADSQRVWLDYVSEFADEVRTDDYGNAVAKVEGGDT
TVALAGHGDEIGFIVRDFTDDGFVKLGRIGGSDKTVSRGQHVTIHTADGPVSGVVGQTAI
HLRDSDDDSVPEISEQHVDVGAVDGDEVESLVDRGDPVTFVQTLSELENGRLAARGMDNR
IGIWAAAEGLRRAAESDADATVYAVSTVQEEVGVQGAKMVGFDLAPDVAIAADVTHATDA
PGSPGKAATGVELGEGPVVARGSANHPVAVDALRETSDAEDIDIQLQATGIRTGTDADAF
YTSRGGIPSVNVGLPNRYMHTPVEVIDPDDLDALADLLAGFAVRAAEQAPFSVDV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgctccatatggacacacgacgacgagagttccttgaatcgctgctgacaacgcccggc
ccgtctggatacgaggccgacagccagcgggtgtggctcgactacgtcagtgagttcgct
gacgaggtccgaacggacgactacgggaacgctgtcgcgaaggtcgagggcggcgacacg
accgttgcgctcgcgggccacggcgacgaaatcgggttcatcgttcgggacttcacagac
gacggcttcgtcaaactgggccgcatcggcggctctgacaagaccgtctcacgcgggcaa
cacgtcactattcacacggctgacggtcccgtttcgggtgtcgtgggacagactgcgatt
cacctccgggattcggacgacgattcagtccccgaaatctccgaacagcacgtcgacgtt
ggggcagtggacggcgacgaggtagaatcgctcgtcgaccgcggcgacccggtgacattc
gtccagacgctgagtgaactggagaacggccgcctcgctgcacgggggatggacaaccgt
atcggcatctgggcggccgctgagggactccgccgcgcagcagagtcagatgcggacgca
acggtgtacgctgtttcgacggtgcaggaagaagtcggcgtacagggtgcgaagatggtc
ggattcgacctcgcgcccgatgtcgccatcgcagcggacgtgacgcacgcaacggacgca
ccgggctcgccgggcaaagccgcgacgggtgtggaactcggcgagggaccggtcgttgcc
cgcgggagcgcgaaccatccggtcgccgtcgatgcgcttcgagaaacgagcgacgccgag
gacattgacatccagttacaggcgaccggtatccggaccgggaccgacgcggacgctttc
tacacctcccgcggtgggattccgtcagtcaacgtcggcctgccgaaccgctacatgcac
acgccggtcgaagtcatcgacccggacgacctcgacgcgctcgcagacctgctggctggc
ttcgccgtccgagcggccgagcaagcgccctttagcgtcgacgtgtag

DBGET integrated database retrieval system