KEGG   Haloarcula marismortui: rrnAC0799Help
Entry
rrnAC0799         CDS       T00211                                 

Gene name
cdlM
Definition
(GenBank) endoglucanase
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(691386..692453)
Genome map
AA seq 355 aa AA seqDB search
MLHMDTRRREFLESLLTTPGPSGYEADSQRVWLDYVSEFADEVRTDDYGNAVAKVEGGDT
TVALAGHGDEIGFIVRDFTDDGFVKLGRIGGSDKTVSRGQHVTIHTADGPVSGVVGQTAI
HLRDSDDDSVPEISEQHVDVGAVDGDEVESLVDRGDPVTFVQTLSELENGRLAARGMDNR
IGIWAAAEGLRRAAESDADATVYAVSTVQEEVGVQGAKMVGFDLAPDVAIAADVTHATDA
PGSPGKAATGVELGEGPVVARGSANHPVAVDALRETSDAEDIDIQLQATGIRTGTDADAF
YTSRGGIPSVNVGLPNRYMHTPVEVIDPDDLDALADLLAGFAVRAAEQAPFSVDV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgctccatatggacacacgacgacgagagttccttgaatcgctgctgacaacgcccggc
ccgtctggatacgaggccgacagccagcgggtgtggctcgactacgtcagtgagttcgct
gacgaggtccgaacggacgactacgggaacgctgtcgcgaaggtcgagggcggcgacacg
accgttgcgctcgcgggccacggcgacgaaatcgggttcatcgttcgggacttcacagac
gacggcttcgtcaaactgggccgcatcggcggctctgacaagaccgtctcacgcgggcaa
cacgtcactattcacacggctgacggtcccgtttcgggtgtcgtgggacagactgcgatt
cacctccgggattcggacgacgattcagtccccgaaatctccgaacagcacgtcgacgtt
ggggcagtggacggcgacgaggtagaatcgctcgtcgaccgcggcgacccggtgacattc
gtccagacgctgagtgaactggagaacggccgcctcgctgcacgggggatggacaaccgt
atcggcatctgggcggccgctgagggactccgccgcgcagcagagtcagatgcggacgca
acggtgtacgctgtttcgacggtgcaggaagaagtcggcgtacagggtgcgaagatggtc
ggattcgacctcgcgcccgatgtcgccatcgcagcggacgtgacgcacgcaacggacgca
ccgggctcgccgggcaaagccgcgacgggtgtggaactcggcgagggaccggtcgttgcc
cgcgggagcgcgaaccatccggtcgccgtcgatgcgcttcgagaaacgagcgacgccgag
gacattgacatccagttacaggcgaccggtatccggaccgggaccgacgcggacgctttc
tacacctcccgcggtgggattccgtcagtcaacgtcggcctgccgaaccgctacatgcac
acgccggtcgaagtcatcgacccggacgacctcgacgcgctcgcagacctgctggctggc
ttcgccgtccgagcggccgagcaagcgccctttagcgtcgacgtgtag

DBGET integrated database retrieval system