KEGG   Haloarcula marismortui: rrnAC0962Help
Entry
rrnAC0962         CDS       T00211                                 

Gene name
pcm3
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Organism
hma  Haloarcula marismortui
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(836916..837530)
Genome map
AA seq 204 aa AA seqDB search
MKKSLDEHAERFSDHADAYDEDQDSAAYRACVNFVVDHAAPESDDVVLDLGTGTGAIAFA
LASDAAEIIGRDISDGMLEKAREKADGRGVENVSFGDGRFRAPNVDRPVDIVTSNFAMHH
LGDDEKREAIDTIADLGPRRIVLGDVMLFGDDDPDAPFYSPEVDDPATVGVLADAFTDAG
YALTAVEMVTEQAGVLVAERVKSD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatcactcgacgagcacgccgagcggttctccgaccacgccgacgcgtacgac
gaggaccaggattcggcggcgtatcgcgcctgcgtcaatttcgttgtcgaccacgcggcc
cccgagagcgacgacgtggtacttgacctcggcacgggcaccggagcgattgcgttcgca
ctcgcgtccgacgcagcggagattatcggccgcgacatcagcgacgggatgctggagaaa
gctcgggagaaagccgacgggcgaggcgtcgagaacgtttccttcggcgacggccgcttc
cgcgctccgaacgtcgaccggccggtggacatcgtcacatcgaactttgcgatgcaccat
cttggcgacgacgagaaacgcgaggctatcgacacaatcgccgacctggggccgcggcgc
attgtcctcggggacgtgatgctgtttggcgacgacgaccccgacgcaccattttacagc
cctgaagtcgacgacccggcgacggtcggcgtcctcgctgatgccttcaccgatgccggc
tacgcactgacggccgtcgagatggttaccgagcaggctggcgtgttggtcgccgaacgc
gttaaatcggactga

DBGET integrated database retrieval system