KEGG   Haloarcula marismortui: rrnAC0974Help
Entry
rrnAC0974         CDS       T00211                                 

Definition
(GenBank) unknown
  KO
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hma  Haloarcula marismortui
Brite
Enzymes [BR:hma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     rrnAC0974
Transfer RNA biogenesis [BR:hma03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    rrnAC0974
Chromosome [BR:hma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    rrnAC0974
   HAT complexes
    Elongator complex
     rrnAC0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(851843..853498)
Genome map
AA seq 551 aa AA seqDB search
MSTETPDPDETETFQQVCAELVDRILAGEVERDDVESAKIDVCREYSAPKVPKNSELLDY
APQEHREVLEEVLQRKPVRTASGVSPIAIMTSPERCPHGKCLYCPGGPDSEFSSAQSYTG
HEPAAARGEQNDYDPYGQVTLRLNQLREIGHPVDKAELIVMGGTMTARSHDYQEWFVKRA
LEAMNDFDVDGEPTPAEDVSFAEDDYEFRYLEDVIAENETADVRNVATTFETKPDWCDPE
QIDRMLDLGATKVEVGVQTTFERINREMHRGHGVQASIDANRRLRDSGFKVGFHMMPGQP
GMSKEMCLEDFRRIFEQTDWRPDYLKIYPTLIVEGTVTYDWWRKDEFDPLDNDEAAELVA
EIKDMIPRYTRLQRVQRDIPADFIEGGVWKSNLRQLAWKRMEEHDWTCDCIRCREAGHSD
DVAENIELDVMTYEACGGMEHFISFEDFENDVLVGFCRLRFPNDPVRRELQDAAIVRELH
VYGNAVGVGQEGDDEDHQHKGYGKKLLEKAEVLARDAGFPKLAVISGIGVRQYYREKLGY
KQDGPYVSKRL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagacgccggacccagacgagacagagaccttccagcaggtgtgtgcggag
ctggtcgaccggattctcgcaggtgaggtcgagcgcgacgacgtcgaatcagccaagatc
gatgtctgccgcgagtactccgcgccgaaagtgccgaaaaactccgaactgctcgattac
gcgccacaggagcaccgcgaggtgctggaggaggttctccagcgcaagccggttcggacc
gcctcgggtgtgtcccccatcgctatcatgacctcgccagagcggtgcccccatgggaag
tgcctgtactgtcccggcggccccgactcggagttctcctccgcccagtcctacaccggt
cacgaacccgcggccgcacgcggcgaacagaacgactacgacccgtacgggcaggtcacc
ctccggctcaaccaacttcgggagatcggccatcccgtggataaggccgaactcatcgtg
atgggcgggacgatgacagcccggagccacgactatcaggagtggttcgtcaagcgagcc
ctcgaagcgatgaatgacttcgatgtggacggagagccgacgcccgcagaggacgtgagc
ttcgccgaagacgactacgagttccgctatctggaggacgttatcgctgagaacgagacc
gccgatgtccgcaacgtcgccacgacgttcgagacgaagcccgactggtgtgaccccgag
cagatcgaccggatgctcgaccttggcgccacgaaagttgaggtgggcgtccagaccacc
ttcgagcgcatcaaccgcgagatgcaccgcggtcacggcgtccaggcctccatcgacgcc
aaccgccgcctgcgcgactcagggttcaaagttggcttccacatgatgccgggccagccc
gggatgtcaaaggagatgtgtctggaggacttccgacgtatcttcgagcagaccgactgg
cggccggactacctcaaaatatacccgacgctgatcgtcgaaggaaccgtcacctatgac
tggtggcgcaaagacgagttcgacccgctggacaacgacgaggccgccgagttagtcgcc
gaaatcaaggatatgattccccgctacacccgacttcagcgcgtccagcgggacatcccg
gctgacttcatcgaaggcggggtctggaagtcgaacctccggcaactcgcctggaagcgg
atggaagaacacgactggacgtgtgactgtatccgctgtcgggaggccggacacagcgat
gacgtcgccgagaacatcgaactcgacgtgatgacctacgaggcctgtggcggcatggaa
cacttcatctccttcgaggacttcgagaacgatgtcctcgtcggcttctgtcggcttcgg
ttccccaacgacccggtgcgccgggagctacaggacgccgcaatcgtccgcgaactccac
gtctacggcaacgccgtcggcgtcgggcaggaaggtgacgatgaggaccaccagcacaaa
ggctacggaaagaaactgctggagaaagcggaggtactggcccgggacgccggcttcccg
aaactggccgtcatttccggcatcggtgtccggcagtactaccgggagaaactggggtac
aagcaggacggcccgtacgtgagcaagcgtctctga

DBGET integrated database retrieval system