KEGG   Haloarcula marismortui: rrnAC0974Help
Entry
rrnAC0974         CDS       T00211                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hma  Haloarcula marismortui
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(851843..853498)
Genome map
AA seq 551 aa AA seqDB search
MSTETPDPDETETFQQVCAELVDRILAGEVERDDVESAKIDVCREYSAPKVPKNSELLDY
APQEHREVLEEVLQRKPVRTASGVSPIAIMTSPERCPHGKCLYCPGGPDSEFSSAQSYTG
HEPAAARGEQNDYDPYGQVTLRLNQLREIGHPVDKAELIVMGGTMTARSHDYQEWFVKRA
LEAMNDFDVDGEPTPAEDVSFAEDDYEFRYLEDVIAENETADVRNVATTFETKPDWCDPE
QIDRMLDLGATKVEVGVQTTFERINREMHRGHGVQASIDANRRLRDSGFKVGFHMMPGQP
GMSKEMCLEDFRRIFEQTDWRPDYLKIYPTLIVEGTVTYDWWRKDEFDPLDNDEAAELVA
EIKDMIPRYTRLQRVQRDIPADFIEGGVWKSNLRQLAWKRMEEHDWTCDCIRCREAGHSD
DVAENIELDVMTYEACGGMEHFISFEDFENDVLVGFCRLRFPNDPVRRELQDAAIVRELH
VYGNAVGVGQEGDDEDHQHKGYGKKLLEKAEVLARDAGFPKLAVISGIGVRQYYREKLGY
KQDGPYVSKRL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggagacgccggacccagacgagacagagaccttccagcaggtgtgtgcggag
ctggtcgaccggattctcgcaggtgaggtcgagcgcgacgacgtcgaatcagccaagatc
gatgtctgccgcgagtactccgcgccgaaagtgccgaaaaactccgaactgctcgattac
gcgccacaggagcaccgcgaggtgctggaggaggttctccagcgcaagccggttcggacc
gcctcgggtgtgtcccccatcgctatcatgacctcgccagagcggtgcccccatgggaag
tgcctgtactgtcccggcggccccgactcggagttctcctccgcccagtcctacaccggt
cacgaacccgcggccgcacgcggcgaacagaacgactacgacccgtacgggcaggtcacc
ctccggctcaaccaacttcgggagatcggccatcccgtggataaggccgaactcatcgtg
atgggcgggacgatgacagcccggagccacgactatcaggagtggttcgtcaagcgagcc
ctcgaagcgatgaatgacttcgatgtggacggagagccgacgcccgcagaggacgtgagc
ttcgccgaagacgactacgagttccgctatctggaggacgttatcgctgagaacgagacc
gccgatgtccgcaacgtcgccacgacgttcgagacgaagcccgactggtgtgaccccgag
cagatcgaccggatgctcgaccttggcgccacgaaagttgaggtgggcgtccagaccacc
ttcgagcgcatcaaccgcgagatgcaccgcggtcacggcgtccaggcctccatcgacgcc
aaccgccgcctgcgcgactcagggttcaaagttggcttccacatgatgccgggccagccc
gggatgtcaaaggagatgtgtctggaggacttccgacgtatcttcgagcagaccgactgg
cggccggactacctcaaaatatacccgacgctgatcgtcgaaggaaccgtcacctatgac
tggtggcgcaaagacgagttcgacccgctggacaacgacgaggccgccgagttagtcgcc
gaaatcaaggatatgattccccgctacacccgacttcagcgcgtccagcgggacatcccg
gctgacttcatcgaaggcggggtctggaagtcgaacctccggcaactcgcctggaagcgg
atggaagaacacgactggacgtgtgactgtatccgctgtcgggaggccggacacagcgat
gacgtcgccgagaacatcgaactcgacgtgatgacctacgaggcctgtggcggcatggaa
cacttcatctccttcgaggacttcgagaacgatgtcctcgtcggcttctgtcggcttcgg
ttccccaacgacccggtgcgccgggagctacaggacgccgcaatcgtccgcgaactccac
gtctacggcaacgccgtcggcgtcgggcaggaaggtgacgatgaggaccaccagcacaaa
ggctacggaaagaaactgctggagaaagcggaggtactggcccgggacgccggcttcccg
aaactggccgtcatttccggcatcggtgtccggcagtactaccgggagaaactggggtac
aagcaggacggcccgtacgtgagcaagcgtctctga

DBGET integrated database retrieval system