KEGG   Haloarcula marismortui: rrnAC1092Help
Entry
rrnAC1092         CDS       T00211                                 

Definition
(GenBank) unknown
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hma  Haloarcula marismortui
Pathway
hma00020  Citrate cycle (TCA cycle)
hma00190  Oxidative phosphorylation
hma00650  Butanoate metabolism
hma00720  Carbon fixation pathways in prokaryotes
hma01100  Metabolic pathways
hma01110  Biosynthesis of secondary metabolites
hma01120  Microbial metabolism in diverse environments
hma01130  Biosynthesis of antibiotics
hma01200  Carbon metabolism
Module
hma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hma_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    rrnAC1092
   00650 Butanoate metabolism
    rrnAC1092
  Energy metabolism
   00190 Oxidative phosphorylation
    rrnAC1092
   00720 Carbon fixation pathways in prokaryotes
    rrnAC1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF2501 DUF2517
Motif
Other DBs
NCBI-ProteinID: AAV46054
UniProt: Q5V348
Position
I:979551..979916
Genome map
AA seq 121 aa AA seqDB search
MAQHYSSFDRGGRRWLFQRLTAVFLIGVLAFHFMLLHFVNHASDITFLGTQARMSQVSYF
ATMWLFLVTATFHGVNGVYNALVNQGLTGSQKNAVKYMLGIAGLLLVVQGTRVSLAMTTL
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcattactcctcctttgaccgcggcgggcgtcgctggctgttccagcgcctg
acagcggtgttcctcatcggcgtgctcgcgttccacttcatgctgttgcacttcgtgaac
cacgcttcggatatcacgttccttggcacgcaggctcggatgagccaggtcagctacttt
gcgacgatgtggctgttcctcgtgaccgcgacgttccacggcgtcaacggcgtgtacaac
gcgctggtcaatcagggactcaccggttcccagaaaaacgcagtcaaatacatgctcggc
atcgctggccttctgctcgtcgtgcaggggacccgcgtgtcgctggccatgacaaccctc
gtctga

DBGET integrated database retrieval system