KEGG   Haloarcula marismortui: rrnAC1092Help
Entry
rrnAC1092         CDS       T00211                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hma  Haloarcula marismortui
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:hma01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hma00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hma00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hma00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:979551..979916
Genome map
AA seq 121 aa AA seqDB search
MAQHYSSFDRGGRRWLFQRLTAVFLIGVLAFHFMLLHFVNHASDITFLGTQARMSQVSYF
ATMWLFLVTATFHGVNGVYNALVNQGLTGSQKNAVKYMLGIAGLLLVVQGTRVSLAMTTL
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcattactcctcctttgaccgcggcgggcgtcgctggctgttccagcgcctg
acagcggtgttcctcatcggcgtgctcgcgttccacttcatgctgttgcacttcgtgaac
cacgcttcggatatcacgttccttggcacgcaggctcggatgagccaggtcagctacttt
gcgacgatgtggctgttcctcgtgaccgcgacgttccacggcgtcaacggcgtgtacaac
gcgctggtcaatcagggactcaccggttcccagaaaaacgcagtcaaatacatgctcggc
atcgctggccttctgctcgtcgtgcaggggacccgcgtgtcgctggccatgacaaccctc
gtctga

DBGET integrated database retrieval system