KEGG   Haloarcula marismortui: rrnAC1225Help
Entry
rrnAC1225         CDS       T00211                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hma  Haloarcula marismortui
Pathway
hma00240  Pyrimidine metabolism
hma00250  Alanine, aspartate and glutamate metabolism
hma01100  Metabolic pathways
Module
hma_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    rrnAC1225 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    rrnAC1225 (pyrB)
Enzymes [BR:hma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     rrnAC1225 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace FTP
Motif
Other DBs
NCBI-ProteinID: AAV46169
UniProt: Q5V2T3
Position
I:complement(1091939..1092853)
Genome map
AA seq 304 aa AA seqDB search
MRHDHIISAKQLSRGDIETVLDHAADIAADPGAFADRHSDTLLGLLFFEPSTRTKMSFTT
AMKRLGGDIVDMGSVESSSVKKGESLADTVRVVEGYTDALVLRHPMEGSAKMASEFVDVP
LVNAGDGAGQHPTQTLLDLYTIRENAGFDDLTIGIMGDLKYGRTVHSLAHALTTVDASQH
FISPESLQLPRSVRYDLHEAGAGIREHTELDDILPELDVLYVTRIQAERFPDESEYREVA
GQYQIDGDTLAAAKDDLTVMHPLPRVDEIAHDVDETTHAQYFQQAHNGVPVRMALLDLML
GGDQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcggcacgaccacatcatcagcgcgaaacaactctcgcggggcgacatcgagacggtg
ctcgaccacgcggctgacatcgcggctgacccgggagcgttcgcggaccggcacagcgac
acgctgcttggcctcctctttttcgagccgagcacccggacgaagatgagcttcacaacg
gcgatgaaacgcctcggcggcgacatcgtcgacatgggctctgtcgagtcctcaagcgtg
aaaaaaggcgagtcactggctgacactgtccgcgtcgtcgaggggtacaccgacgcgctc
gtgctccggcacccgatggagggttccgcgaagatggcgagcgagttcgtcgacgtgccg
ctcgtcaacgccggcgacggggccggtcagcacccgacacagacgctgctcgacctctac
acgatccgtgaaaacgccggcttcgacgacttgactatcggcatcatgggcgacctgaag
tacggacgaaccgtccactcgctggcccacgcactcacgaccgtcgacgccagccagcac
ttcattagcccggagtcgctccagcttccgcggtcggttcgctacgacctccacgaggcc
ggcgcaggcatccgcgaacacaccgaacttgacgacatactcccggaactggacgtgctc
tacgtgacccgcatccaggccgagcggttccccgacgagagcgagtaccgcgaagtcgcc
ggccagtaccagatcgacggcgacacgcttgcggcggccaaagacgacctgaccgtgatg
catccgctcccacgcgttgacgagatcgctcacgacgtcgacgagaccacccacgcacag
tacttccagcaggcccacaacggtgttcccgtacggatggcgctgcttgacctgatgctc
ggaggcgaccaatga

DBGET integrated database retrieval system