KEGG   Haloarcula marismortui: rrnAC1341Help
Entry
rrnAC1341         CDS       T00211                                 

Gene name
acs
Definition
(RefSeq) hypothetical protein
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC1341 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC1341 (acs)
   00620 Pyruvate metabolism
    rrnAC1341 (acs)
   00640 Propanoate metabolism
    rrnAC1341 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    rrnAC1341 (acs)
   00680 Methane metabolism
    rrnAC1341 (acs)
Enzymes [BR:hma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     rrnAC1341 (acs)
Lipid biosynthesis proteins [BR:hma01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   rrnAC1341 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1194038..1195837
Genome map
AA seq 599 aa AA seqDB search
MSVESTVKSGGEDGKFCRLGCGDGGSTERRNSHPDDRYAMVWTVMPDFEGYDEAHEQFSW
DLPSSYNPAVDFLQKHEDPGRVALEQAYPDGQREQYTFRELDELSDRLAAGLASLGVEAG
DRVGVVVPQKPQNPITHLANWKLGAVSVPLTVLFGTDALQYRLDDAGATVAVIDPTVRDD
IDAIREDCPTLEHVLEIETDAPAGDVHAFGDMLAAPENTDIEPYDSTPDTDTAILYTSGS
TGPPKGVRHSHALWLGRAAAAYNFFDQGLGPDATVWTPADWAWGAALGGTLFATWHHGGT
IVGYPASGFEAEAAFDLLSEFDITRSFMPATALRMLMDIEDPTTTYDLAIETFAVGGESL
TPEIVDWVAETFDSVTINEFYGQTELNLVVANNSNWFDTQPSSMGKPLPGYDLAILDPDA
ADRGVAAPLSTGELGEIAVRPHDRSVFFDEYWNMPEKTAAKEVDGWFVTGDLARQDADGY
VWFKSRKDDVIITSGYRVGPMEVESAILEHPDAVQAGVIGVPDDTRGEIIKAYVEASADA
PAHETLRSEIRSIVREHLAEYEYPREIEFADALPQTTSGKIRRKELQAWNADDSAGESP
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagagtccacggtgaagtcgggaggggaagacggaaagttctgccggctcggg
tgtggcgacggtggttcgaccgaaagacgcaacagccacccagacgaccggtatgccatg
gtctggacagtgatgccggacttcgaggggtacgacgaggcccacgagcagttcagctgg
gaccttccgtcgtcgtacaatccggcggtcgattttctgcaaaaacacgaggaccccggc
agggtggcgctcgaacaggcatatcctgacggacagcgcgagcagtacaccttccgcgaa
ctggacgagctatcggacagactcgcggcggggttggccagtctcggcgtcgaggccggt
gaccgggtcggcgtcgtcgtgccacagaagccacagaacccaataacgcacctggcgaac
tggaagctcggggccgtctcggtgccgttgacggtcctgttcgggacggacgcgctccag
taccggctggacgacgctggcgcgaccgtcgccgttatcgacccgaccgtgcgcgatgat
atcgacgcgatacgcgaggactgtccgacgctagagcacgtcctcgaaatcgaaactgac
gcaccggctggtgatgtccacgccttcggcgatatgcttgctgcgccggaaaacaccgac
atcgaaccctacgactccacgccggacactgacacggcgatactgtacacgagcgggtcg
acgggaccgccgaaaggcgtccggcactcacacgcactgtggctcggacgagccgcagcc
gcgtacaactttttcgaccaagggctgggaccggacgcgacagtctggacgcccgcggac
tgggcctggggcgcggccctcggcgggacactctttgcgacgtggcatcacggtggaacc
atcgtcggctatcccgcctcagggttcgaggccgaggcggcgttcgacctgctgtccgag
ttcgatatcacccggtcgttcatgccggccaccgccctccgaatgctgatggatatcgag
gacccgacaacgacgtacgacctcgccatcgagacgtttgccgtcggcggcgagtcgttg
accccggaaatcgtcgactgggtggcggagacgttcgactcggtcaccatcaacgagttt
tacggccagacagaactgaatctcgttgtcgccaacaactcgaactggttcgacacacag
cccagcagcatgggcaagccgttaccggggtatgacctagcgattctggaccccgacgcc
gccgaccgcggcgttgctgcgccgctctcgaccggcgaactcggcgagatagcggtacga
ccgcacgaccgctcggtgttcttcgacgagtactggaacatgccggagaagacggcggcc
aaagaggtcgacggctggttcgttaccggcgacttggcacgacaggacgccgacggctac
gtctggttcaaatcgcgcaaggacgacgttatcatcaccagtggctaccgcgtcgggccg
atggaggtcgagagcgcgattctcgaacaccccgacgcagttcaggcgggcgtcatcggt
gtcccggacgacacccggggcgaaatcatcaaagcgtacgtggaagcatcggccgatgcg
ccggcccacgagacgctccggtcagaaatccgatctatcgtcagagagcaccttgccgag
tacgaatacccccgcgagatcgagttcgctgatgcgctgccacagacgacaagcgggaag
atccgccggaaagaattacaggcgtggaatgccgacgacagcgccggcgagtcgccgtag

DBGET integrated database retrieval system