KEGG   Haloarcula marismortui: rrnAC1359Help
Entry
rrnAC1359         CDS       T00211                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hma  Haloarcula marismortui
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hma00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1210805..1211899)
Genome map
AA seq 364 aa AA seqDB search
MQGADADTVADALASDDALPGAGGFAGELDGTLVRDVLGRYPLFVERAVSDEARLDPGQW
SHDPTALADPRSFPAGHIRNESGTQQRWSLPSLDPFGDRETAIETVGETVETSIDAVDTD
SLAIAFSGGVDSALLAARLDAPLYVAGFPDSHDIEAARSAAELLGTEVRVVELTHDAIER
AVPEIARATARTNAMDVQIALPLYLVAERVAGDGFDRLALGQGADELFGGYAKVAKAPED
PRVEADTVRGAQREVIASLPDQLERDVLALRAAGVEPVTPLLHDRVIGAALRLDGDLLVD
GETRKVALRAAARESLPDEIADRDKKAAQYGSLAARELDRLARQAGYKRRMDDHVTQYVE
SLVE
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagccgatgcggacaccgtcgccgacgccctcgcaagcgacgacgcgctcccg
ggtgctggcggcttcgcgggcgaacttgacggaacgctcgtccgcgacgttctcggacgg
tacccgctgttcgtggagcgtgccgtttctgacgaggcgcggcttgaccccggacagtgg
agccacgacccgacggcgctggccgacccgcggtcgttccctgccggccatattcgaaac
gagagcgggacccaacagcggtggtcgctcccgtcgttggacccgttcggagaccgtgaa
acagctatcgagacggtcggtgagactgtcgagacgagcattgacgctgtcgacactgac
tctctcgcaatcgccttttctggcggcgtggactcggcgctgctcgcggcccgactcgac
gcgccgctgtacgtcgccgggttcccggacagccacgatatcgaggcggcgcggtcagcc
gccgaactgctggggaccgaggtccgcgtggtcgaactcacccacgacgccatcgaacgg
gccgtccccgagatcgctcgcgccaccgcacgcacgaacgcgatggacgtacagatagcg
ctcccgctgtacctcgtcgccgagcgggttgccggagacggtttcgaccgactggcgctc
ggccagggagccgacgagctgttcggcggctacgcgaaagtcgccaaggctccagaagac
cctcgcgtcgaggccgacaccgtccgcggggctcagcgggaggtcatcgcctcgctcccc
gaccaactggagcgggacgtgctcgccttgcgggccgccggcgtcgagccggtaacgccg
ctgttacacgaccgcgttattggtgccgcgctccgactggacggcgacctgctcgtcgac
ggcgagacgcgaaaggtcgcgctccgggcggcggcccgggaatcgctcccggacgagatt
gcggaccgggataaaaaggccgcccagtacggctcgcttgccgcccgagaactcgaccgg
ctggcgcgacaggccggctacaagcgccggatggacgaccacgttacccagtacgtcgaa
tcgctcgtggagtga

DBGET integrated database retrieval system