KEGG   Haloarcula marismortui: rrnAC1372Help
Entry
rrnAC1372         CDS       T00211                                 

Gene name
ccpA
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hma  Haloarcula marismortui
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1221340..1222764)
Genome map
AA seq 474 aa AA seqDB search
MRYMSRQPLARAVFVVGMSLLLIGGPIVSTVGAVDGGPSGEAVSDTLDETAQQTAQTSNQ
SSNETSDLPVEPPTSQPLPSYEEVRKPNDTEAKIELGKKLFFDPRLSDTGSISCNTCHNV
MEGGDGSRTVGRGVHGQTGPRNSPTVWNAVFMSTQFWDGRADTLEAQAKGPITAGVEMGM
PTSEAAMEKIRNNEGYVELYEDVYGGEDPVTLNNTVDAIAAYERTLITPNSSYDRYVRGD
EDALTERQLNGMETFKELGCQGCHSGPAFNGPQWQMENGNGYYQKLGVYQGSNPQCDQYI
DRYNLYADSGRAGVTGDSSDEHMFKVPTLRNVEHTAPYFHNGQVRTLENATKVMASCQVG
QNISDQQAENVTAFMTSLTGQYPEQQMPRIPSRSGGEPMLPEDAGDASAPDTDDAASVGT
PAETAAAQQTAEPQQAGVSGGSSDGSSPTSAAAFMMAAALLIALLAVAYAQRKR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcggtatatgtcgcgacagccgttggctcgcgccgtcttcgtcgttggcatgtcgcta
ctgttgattggcggacctattgtaagcaccgtcggtgctgtggatggggggccgtcaggt
gaagcagtgagcgacacgcttgacgagacagcgcaacagaccgcacagacgagtaatcag
agtagcaacgagacgtccgatttacccgtcgaaccaccaaccagtcagccgctgccgtcc
tatgaggaagtccggaagccaaatgacacggaggcaaagatcgaactcggcaagaaactg
ttcttcgatccgcgcctctctgacaccggctctatctcctgtaacacctgccacaacgtg
atggaaggtggcgacggcagccgaactgtcggtcgcggtgtccacggccagaccgggccg
cgcaactcgccgacggtgtggaacgccgtgttcatgagcactcagttctgggacggccgc
gccgacacgcttgaagcgcaggcaaaaggtcccatcaccgcaggcgtcgagatggggatg
ccgacctccgaggcggcgatggagaagatacgtaacaacgagggctacgttgagctgtac
gaagatgtctacggcggtgaggacccggtcacgctcaacaacaccgtcgacgcaatcgct
gcctacgagcggacgctcatcacgccgaacagctcgtacgaccggtacgtcagaggtgac
gaggacgccctgaccgaacggcagctcaacgggatggagacgttcaaggaactgggctgt
cagggctgtcactccggccccgcgttcaacggcccgcagtggcagatggagaacggaaac
ggatactaccagaagctaggcgtctaccagggttcgaacccgcagtgtgaccagtacatc
gaccgatacaacctgtacgctgactccgggcgcgccggagtgaccggtgacagcagtgac
gagcatatgttcaaggttccgacgctccggaacgtcgagcacacagcgccgtacttccac
aacggtcaggtccggacgctagagaacgcgacgaaggtgatggcgtcctgtcaggtcggc
cagaatatctccgaccagcaggccgagaacgtcaccgcgttcatgaccagcctcaccgga
cagtaccccgagcagcaaatgccgcgtatcccgtcccggagtggcggcgagccgatgctc
cccgaagatgcgggcgacgcatctgcgccggacactgacgacgctgcttcggtcggaacg
cccgcagagacggccgcagcacagcagacagcggaaccacagcaggcaggggtcagcggc
ggtagcagcgacgggagttccccgaccagtgccgccgcgttcatgatggccgcggcgttg
ctcatcgcgctccttgctgtggcgtacgcccagcgcaagcggtaa

DBGET integrated database retrieval system