KEGG   Haloarcula marismortui: rrnAC1934Help
Entry
rrnAC1934         CDS       T00211                                 

Gene name
hisC1
Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
hma  Haloarcula marismortui
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    rrnAC1934 (hisC1)
  Amino acid metabolism
   00340 Histidine metabolism
    rrnAC1934 (hisC1)
   00350 Tyrosine metabolism
    rrnAC1934 (hisC1)
   00360 Phenylalanine metabolism
    rrnAC1934 (hisC1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    rrnAC1934 (hisC1)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    rrnAC1934 (hisC1)
Enzymes [BR:hma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     rrnAC1934 (hisC1)
Amino acid related enzymes [BR:hma01007]
 Aminotransferase (transaminase)
  Class II
   rrnAC1934 (hisC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1724453..1725511
Genome map
AA seq 352 aa AA seqDB search
MDPDSVEGLRASGGNGAEDAIGPDGRVPHGSSDDPDLLDFSANTNPRVPPDAAKTYREAF
EAARSYPADDYPEFRAAAASFVDCEPEQVIPTAGGLEAIRLAIQTTVRAGDSVLVPYPSF
GEYAREVRLQDGTPEFVPHNDLLTADPDGHALAIVCNPNNPTGEAADPSALRAFADDCLS
AGTTLLVDEAFLGFTDEQSLAGREGVIVARSLTKLFGLPGIRMGYAVGTGDAGDRLATAR
RAWSMSAAAAAVGAHCYGQHEFVAETKARVADERARMRERLGDRFDVSPSDAPFLLLSVS
EADESVDDILASAREAGIALRDARTFRGLDSHIRVAVRAPEENDRLLDALDV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgattcggtcgagggcttgcgggcgagtggcggcaacggggccgaggacgcc
atcgggccggacgggcgcgtcccacacggcagcagcgacgacccggacctgctggatttc
agcgcgaacacgaacccccgcgtcccgccggacgccgcgaagacgtaccgggaagcgttc
gaggccgcccgctcgtatccggcggacgactaccccgagttccgggcggccgcggcgtcc
tttgtcgactgcgaaccggaacaggtgatacccacggccggtggcctcgaagcgattcgc
ctggcgatccagacgacggtccgggccggcgacagcgtgctcgtcccgtatcccagtttc
ggtgagtacgcccgcgaggtccggctccaggacgggacgccggagttcgtcccacacaac
gacctgctgaccgccgacccggacggtcatgcgctcgccatcgtctgcaacccgaacaat
ccgaccggcgaagcggccgacccgtcggcgctccgggccttcgccgacgactgtctctct
gctgggacgacactgctggtcgacgaagcctttctcggctttaccgacgagcagtcgctg
gcgggccgtgagggcgtcatcgtcgcacgctcgctgacgaagctattcggtctccccggc
atccggatgggctatgccgtcgggaccggcgacgccggggaccgactcgccaccgcgcga
cgtgcctggtcgatgagcgccgccgcggctgcggtgggcgcacactgctacggacaacac
gagttcgtcgcggagacgaaagcccgtgtcgccgacgagcgagcacggatgcgcgagcgt
ctcggcgaccgcttcgacgtgtccccctccgatgcgccgttcctgttgctgtcagtcagc
gaggccgacgagtccgtcgacgatatcctcgcctcggcccgcgaggctggtatcgcactc
cgggatgcccgcaccttccgggggctggactcgcacatccgcgtcgctgtcagagccccc
gaagaaaacgaccggctgctggatgcgctggatgtttga

DBGET integrated database retrieval system