KEGG   Haloarcula marismortui: rrnAC1934Help
Entry
rrnAC1934         CDS       T00211                                 

Gene name
hisC1
Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
hma  Haloarcula marismortui
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hma01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hma00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hma00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:hma00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hma00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:hma00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1724453..1725511
Genome map
AA seq 352 aa AA seqDB search
MDPDSVEGLRASGGNGAEDAIGPDGRVPHGSSDDPDLLDFSANTNPRVPPDAAKTYREAF
EAARSYPADDYPEFRAAAASFVDCEPEQVIPTAGGLEAIRLAIQTTVRAGDSVLVPYPSF
GEYAREVRLQDGTPEFVPHNDLLTADPDGHALAIVCNPNNPTGEAADPSALRAFADDCLS
AGTTLLVDEAFLGFTDEQSLAGREGVIVARSLTKLFGLPGIRMGYAVGTGDAGDRLATAR
RAWSMSAAAAAVGAHCYGQHEFVAETKARVADERARMRERLGDRFDVSPSDAPFLLLSVS
EADESVDDILASAREAGIALRDARTFRGLDSHIRVAVRAPEENDRLLDALDV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgattcggtcgagggcttgcgggcgagtggcggcaacggggccgaggacgcc
atcgggccggacgggcgcgtcccacacggcagcagcgacgacccggacctgctggatttc
agcgcgaacacgaacccccgcgtcccgccggacgccgcgaagacgtaccgggaagcgttc
gaggccgcccgctcgtatccggcggacgactaccccgagttccgggcggccgcggcgtcc
tttgtcgactgcgaaccggaacaggtgatacccacggccggtggcctcgaagcgattcgc
ctggcgatccagacgacggtccgggccggcgacagcgtgctcgtcccgtatcccagtttc
ggtgagtacgcccgcgaggtccggctccaggacgggacgccggagttcgtcccacacaac
gacctgctgaccgccgacccggacggtcatgcgctcgccatcgtctgcaacccgaacaat
ccgaccggcgaagcggccgacccgtcggcgctccgggccttcgccgacgactgtctctct
gctgggacgacactgctggtcgacgaagcctttctcggctttaccgacgagcagtcgctg
gcgggccgtgagggcgtcatcgtcgcacgctcgctgacgaagctattcggtctccccggc
atccggatgggctatgccgtcgggaccggcgacgccggggaccgactcgccaccgcgcga
cgtgcctggtcgatgagcgccgccgcggctgcggtgggcgcacactgctacggacaacac
gagttcgtcgcggagacgaaagcccgtgtcgccgacgagcgagcacggatgcgcgagcgt
ctcggcgaccgcttcgacgtgtccccctccgatgcgccgttcctgttgctgtcagtcagc
gaggccgacgagtccgtcgacgatatcctcgcctcggcccgcgaggctggtatcgcactc
cgggatgcccgcaccttccgggggctggactcgcacatccgcgtcgctgtcagagccccc
gaagaaaacgaccggctgctggatgcgctggatgtttga

DBGET integrated database retrieval system