KEGG   Haloarcula marismortui: rrnAC2064Help
Entry
rrnAC2064         CDS       T00211                                 

Gene name
aor1
Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hma  Haloarcula marismortui
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    rrnAC2064 (aor1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    rrnAC2064 (aor1)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     rrnAC2064 (aor1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1847523..1849469)
Genome map
AA seq 648 aa AA seqDB search
MTDLGGFQDHVARIDLGDGDVAYEGIDEEDAKKYIGARGLGVKYVFDQGPDVDPLGPENL
LAFMNGPLTGTQVTMSGRIAICTKSPLTGTVTDSHHGGWSGARLKWSGFDGLLFEGQADE
PVYALVEDGEVELRDASHLWGQGVHDTIDDLEGEIEGGSLGKNLSVMAIGQGGENEVKYA
CIVNEDDRASGRGGTGCVMGNKNLKAVVVKSSTRMPKPKDQETFQEGHKQAMQVIQESDV
TAPNEGGLSMYGTNVLMNPTEEMDGLPTKNGKYSSTRAYSDAEGDGERIIDSENVSGENV
RENILVDEPTCHSCPVACKKEVEVQAMHKGEEMNVRTESYEYESAWALGPNSGHVERDKI
AVMLDRCNDLGVDTIDVGNTMAMTMEMTEEGKLDELDDGLDWGDAETMIDMIEMIAHRET
ELADHLAEGPDHLAEEFDAHTNSLAVKGQTMAAYDPRCMKGMAIGYATSNRGACHLRGYT
PAAEILGIPEKVDPREWEGKGELCATFQDLHAISDSFDICKFNAFAEGIEEYVLQYNGMT
GLDVSEEELMEAGERVYNLERYYNNLAGFDGSDDDLPNRFVEGDEHAMPAQGGSEGELAE
LSKMKDEYYEVRGWENGVVPDEKLDELGIDIGPGTGVSSGGAAAPSDD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttggtggctttcaggaccacgtggcacggatcgacctcggagacggggac
gtagcctacgaaggtattgacgaggaagacgcgaaaaagtatatcggtgcacgcggactc
ggcgtgaagtatgtcttcgaccaggggccggacgttgacccgcttgggccggagaacctg
ctggcgttcatgaacgggccgctgacggggacacaggtgacgatgagcggtcgtatcgcc
atctgtacgaagtcgccgctgacggggaccgtcactgattcccaccacggcggctggtcc
ggggcgcgactgaagtggtcgggcttcgacggactgctgttcgaagggcaggctgacgag
ccggtgtatgcgctcgtcgaagacggcgaagtggaactgcgcgacgcctcacacctctgg
gggcagggcgtccacgacactatcgacgacctcgaaggcgaaatcgagggcggctcgctg
ggcaagaacctttccgtaatggccatcggccagggcggtgagaacgaggtcaaatacgcc
tgtatcgtcaacgaggacgaccgcgcgtcgggtcgcggtggcaccggctgcgtgatgggc
aacaagaacctcaaagccgtcgtcgtcaagtccagcactcggatgccgaagccaaaagac
caagagacgttccaggagggccacaagcaggcgatgcaggtcatccaggaatccgacgtg
accgcgcccaatgaaggcggactctcgatgtacgggaccaacgtcctgatgaatcccacc
gaggagatggacggtctcccgacgaaaaacgggaagtactcgtcgacgcgagcgtactcg
gacgccgagggcgacggcgagcgtatcatcgactcagagaacgtctcgggcgaaaacgtc
cgggagaacatccttgttgacgagccgacctgtcactcctgtccggtcgcctgcaagaag
gaagtcgaggtgcaggcgatgcacaagggcgaggagatgaacgtccgcaccgaatcctac
gagtacgagtccgcgtgggcgctcggcccgaactccggccacgtcgaacgcgacaagatt
gcagtgatgctcgaccggtgtaacgacctcggcgtcgacaccatcgatgttggtaacacc
atggcgatgacgatggagatgaccgaggagggcaaactcgacgaactcgacgacggtctg
gactggggcgacgccgagacgatgatcgacatgatcgagatgatcgcccaccgcgagacg
gaactcgcggaccacctcgccgaggggccggaccatctcgccgaggagttcgacgctcac
accaactctctcgcggtcaaaggccagacgatggccgcctacgacccgcgctgtatgaag
gggatggcaatcgggtacgcgacctcaaaccgtggggcgtgtcacctgcgcggctacacc
ccagcagccgaaattctcggtatcccggagaaggttgacccgcgagagtgggagggcaaa
ggcgagctgtgtgctaccttccaggacctgcacgctatcagtgactccttcgacatctgc
aagttcaacgccttcgcggaaggtatcgaggagtacgtcctgcagtacaacggcatgact
gggctggacgtgagcgaggaggaactgatggaggccggcgagcgcgtctacaacctcgaa
cggtactacaacaacctcgcgggcttcgacgggtccgacgacgacctgccaaaccggttc
gtggagggcgacgagcacgcgatgccagcccaaggcggttccgagggcgaactcgcggaa
ctctcgaagatgaaagacgagtactacgaggtccgtggctgggagaacggcgtcgttccc
gacgagaaactcgacgaactgggaatcgatatcggccccggaaccggcgtcagctccggc
ggcgcagcggcaccgagcgacgactga

DBGET integrated database retrieval system