KEGG   Haloarcula marismortui: rrnAC2172Help
Entry
rrnAC2172         CDS       T00211                                 

Gene name
adh14
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    rrnAC2172 (adh14)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    rrnAC2172 (adh14)
  Lipid metabolism
   00071 Fatty acid degradation
    rrnAC2172 (adh14)
  Amino acid metabolism
   00350 Tyrosine metabolism
    rrnAC2172 (adh14)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    rrnAC2172 (adh14)
   00626 Naphthalene degradation
    rrnAC2172 (adh14)
Enzymes [BR:hma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     rrnAC2172 (adh14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1940106..1941173
Genome map
AA seq 355 aa AA seqDB search
MRAAVLEAYGEPLAVRDRDPPTPNPDGAVVAVEACGICRSDWHAWQGHGDWADDDVPIGQ
VLGHEPAGRVTATGNQVTTVSVGDRVVVPFNLGDGTCGYCRNGHGNVCTDGWALGFESDA
PGAFAEQVAVPQADYNLVGLPDGVSSDAAAALGCRYVTAFHALAHRADIAAGDRVAVHGC
GGLGLAAVQIASALGASVIAVDIRDEPLAMARDAGASTVVDASAVEDVPAAIEGETDGGA
EVSVDALGRAETCQNSVRSLRPRGTHVQVGLTTNAERGEVALPTDWITRWDIDVLGSRGM
PPSRYDELLRLVADGPLDPGALVTRRVALEAVSERLAAMTDYGTDGIELVTEFGR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggcagtgcttgaggcgtacggcgaaccgctggccgtccgggaccgcgacccg
ccgacgccgaacccggacggggccgtcgtcgcggtcgaggcgtgtgggatctgtcggagc
gactggcacgcctggcagggccacggcgactgggccgacgacgacgtgccgatagggcag
gtgctgggtcacgaaccggcgggtcgcgtcaccgcaacgggcaaccaggtgacgacagtg
tcggtcggcgaccgcgtcgtcgtgccgttcaacctcggcgacgggacctgtggctactgc
cggaacggtcacggcaacgtctgtacagacgggtgggcgctgggcttcgaatccgatgcg
ccgggcgcgtttgccgagcaggtcgccgtcccgcaggccgactacaacctcgtggggctg
cccgacggcgtcagctccgacgccgcggcggcgcttggctgtcgatacgtcacagcgttc
cacgcactggcccatcgggccgatatcgccgccggggaccgcgtcgcggtgcatggctgt
ggcggcctcgggctggcagccgtccagatcgcgtcggcactgggtgcgagcgtcatcgcc
gtcgacatccgggacgagccgctggcgatggcccgtgacgcgggcgcaagcaccgttgtc
gacgccagcgctgtcgaggacgtgccggcggccatcgagggcgaaacggacggcggcgcg
gaggtgtccgtcgatgcgctgggccgagccgagacctgtcaaaacagcgttcggagcctc
cgcccacgggggacacacgttcaggtcgggctgacgaccaacgccgagcgcggcgaggtg
gcgctgccgaccgactggattacccgctgggacatcgacgtgctcggctctcgcgggatg
ccgccgtcgcggtacgacgaactcctccgactggtcgctgacgggccactcgaccccggt
gcgctcgtcactcgccgagtcgcgctagaggcggtttcggagcggctggcggcgatgacc
gactacggaaccgacggcatcgaactggtgacagagttcggtcggtag

DBGET integrated database retrieval system