KEGG   Haloarcula marismortui: rrnAC2256Help
Entry
rrnAC2256         CDS       T00211                                 

Gene name
pcm2
Definition
protein-L-isoaspartate O-methyltransferase 2 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hma  Haloarcula marismortui
Brite
Enzymes [BR:hma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     rrnAC2256 (pcm2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2008850..2009581)
Genome map
AA seq 243 aa AA seqDB search
MDPAVLRDDMVDSLQHESKGVVRSAWLSTAMRAVPREAFVGEQQAYSDRPFERLGTRVLS
PSTAGRVLETLSPEEDDDVLVVGAGVGYTAAVLAEQVGAANVHAIDITRRLVIEARQNLA
EAGYDAVLVDRRDGADGLPEYAPYDRILLEAAAIDPPRALLQQLTDDGRLVMPLGTGEQS
LAVVEADGSVKRHGTVAFQPMLVEGEQADTVERNRTHREDRERARRAAQSRAGWEQEWID
WDG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggatccggcggtattgcgggacgacatggtcgacagcctccaacacgagagtaagggt
gtcgtccggagcgcgtggctgtcgacagcgatgcgtgccgtccccagagaggcgttcgtc
ggcgagcaacaggcttactccgaccgcccgtttgaacgcctcggcacgcgcgttctttcg
cccagtaccgccggccgggtgctcgaaaccctgtcacccgaggaagacgacgatgtgctc
gtggtcggtgccggcgtcggctacacggccgccgtgctggcagaacaggtcggcgcagcg
aacgttcatgcgatagatatcacgcgccgcctcgtcatcgaagcgcgccagaatctggca
gaagcaggctatgacgccgtcctcgtggaccgtcgtgacggcgctgacggactcccggag
tacgcaccgtacgaccgcattctcttggaagccgccgcaatcgacccaccccgagcgctc
ctccagcaactaaccgacgacggccgcctcgtgatgccgcttggcaccggcgagcagtca
ctggccgtcgtggaggccgatggctcggtcaagcgacacggcactgtcgcgttccagccg
atgctcgtcgagggcgaacaggctgataccgtcgagcgcaaccggactcaccgtgaagac
cgcgagcgtgcccgccgggccgcccagtcccgcgccggctgggagcaggaatggattgac
tgggacggctag

DBGET integrated database retrieval system