KEGG   Haloarcula marismortui: rrnAC2258Help
Entry
rrnAC2258         CDS       T00211                                 

Gene name
pcm1
Definition
protein-L-isoaspartate O-methyltransferase 1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hma  Haloarcula marismortui
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2009643..2010077)
Genome map
AA seq 144 aa AA seqDB search
MVAIMSELLDLSPGDQVLEIGTGCGYHAAVTAELVGPENVFSVEYHATLADEARETLAAT
GYGSVSVRAGDGKQGWPEHAPYDRTYLTCAAPDFPAPLVEQTHDGGVLLAPIGDGQQRLI
RAEKQAGGTLEKEDHGSVRFVPLQ
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcaattatgtccgagttactcgacctgtcccccggagatcaggtactggagatc
ggcacgggctgtggctaccacgccgcggtgactgctgagctggtcggcccagagaacgtc
ttcagcgtggagtaccacgcgacgctggcagacgaggcacgcgagacactagcagcgacc
ggctacggcagcgtttctgttcgagccggtgacggcaagcaggggtggccagaacacgcg
ccctacgaccggacgtatctgacctgtgccgcgccggatttccccgccccgctcgtcgag
cagacccacgatggtggcgtcctgctggctccgatcggcgacggccaacagcgactcatc
cgagcggagaaacaggctggcggcacgctcgaaaaagaggatcacggcagcgtccggttc
gtcccgttgcagtag

DBGET integrated database retrieval system