KEGG   Haloarcula marismortui: rrnAC2262Help
Entry
rrnAC2262         CDS       T00211                                 

Gene name
gapB
Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hma  Haloarcula marismortui
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hma01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hma01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hma00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2012779..2013843
Genome map
AA seq 354 aa AA seqDB search
MLHVGINGFGTIGKRVADAVRVQPDMTVAGVAKRSPNFEATIADDRGYDLYAADGREPFD
EADLGTAGTVHDLIETSDVVVDTTPSGVGAANASLYAEHDTPAIFQGGEDADVADVSFNA
RANYEKAVGADTARVVSCNTTGLSRLLAPLRESYGVEKSRVTLVRRGADPGQTGRGPIND
TLPDPVEIPSHHGPDVQTIFPDLDIDTMGMKVPTTQMHTHSVNVTLESEPATEEVTALLA
DESRLFLIPETLGIDGAGKLKEYTRDAGRPRGDVWENCIWAESITVEGRDLYLFQAIHQE
ADVVPENIDAVRALSERTASAEKSIRRTDEALGVGRGLVEHDGSPQRVDSHADD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctccacgtgggcatcaacggcttcggcaccatcgggaaacgcgtcgctgacgcggtg
cgtgtccagccagatatgacagttgcgggcgtcgcaaagcgctcgccgaacttcgaggca
actatcgcggacgaccgcggctatgatctctacgccgcggacggccgcgaaccgttcgat
gaagccgatctcggtacggccggtacggtccatgaccttatcgagacgagcgacgtggtc
gtcgacaccacgccaagtggcgtcggcgcggccaacgcgtcgctatacgccgaacatgac
acgccggccatcttccagggtggagaggacgccgatgtggcagacgtgagcttcaacgct
cgcgccaactacgagaaggcagtcggggctgatacggcccgcgtcgtgtcatgcaataca
acgggcctttcacgcctgctcgcaccgcttagggaatcatacggcgttgaaaaatcgcgt
gtgacactggtacggcgcggtgccgacccgggccagaccggtcgtggcccgatcaacgac
acactccccgaccccgtcgaaatcccctcccaccacggtcccgacgtccagacgattttt
cccgaccttgacatcgatacgatgggcatgaaggtcccgacgacgcagatgcacacccac
agcgtcaacgtcacgctggaaagcgaacccgccacagaggaggtcacggcgctgctcgcc
gacgaatcgcggctgttcctcatcccggagacgctcggtatcgacggcgcagggaaactc
aaagagtacacccgtgacgccggtcgcccgcgtggtgacgtgtgggagaactgtatctgg
gccgaatccatcacagttgaggggcgggacctctatctgttccaggcgattcaccaggaa
gccgatgtcgtgccggagaacatcgacgccgttcgcgcgctctcagagcggaccgcaagc
gctgaaaagagcatccgccggaccgacgaagccctcggtgtcgggcgcggcctcgtcgaa
cacgacgggagcccgcaacgcgtcgacagtcacgccgacgactga

DBGET integrated database retrieval system