KEGG   Haloarcula marismortui: rrnAC2353Help
Entry
rrnAC2353         CDS       T00211                                 

Gene name
cga-2
Definition
glucan 14-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
hma  Haloarcula marismortui
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hma00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2095847..2097865)
Genome map
AA seq 672 aa AA seqDB search
MTLRTALNDFKRTRDRRHQFPGELRSTTGSFSGLDSRLVHVDNDGSLRDYSYPLCGLTGI
DRSRFGIETGSTTWFSADADQRYRGDAGVVETIHDCGDWAVVQTDCTIEQAHVTRFELRG
DAPADVSLRAFVDFAPDGRTGQQSLLMHGNSVEAYHRSEHDFIGVSTELDTVAGQIPERF
SELVDDDPVSFPRDTGARRYEDTTLTGGVLLSAPFVDGGVTLTTLLTDANDTDRDTALST
IDRLVSDHYTSETLLEAGQAQRRWTVPAETPNRESVVADLRVLSLLSAANGARIAAPDFD
PYYVTSGGYGYTWFRDDAEISAFLLEADGTFDLGLDSWHQRSAEFYCRTQQPDGSWPHRV
WPGDETLAPGWANARLESGSDADYQADQTASVTSFLATYLRTGEPADPECIEATLGRAVE
SIDDTLADDGLPIACQNAWENMQGRFTHTAATFLHAYAAVARAPVCATLRDHARSQAETV
LSSLDALWTGDRYALREHDGTIDNRLDSATLALPAACRVAAEAIDLPAETRDRLYTHVET
TLDGLERDTGDIRGLIRFEGDDWRRGSQDREKIWTVSTAWGANSAAQLGALLRDADDSRA
AAAYTRSRDLLGEILPGGSLVQSSGYLPEQLFDDGTPDCGTPLGWPHALRLATVAHLDDA
GELTAEPLSVRE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccggacggcactcaacgacttcaagcggacgcgggaccgccgccaccagttc
ccgggtgaactccgctctacgacgggcagtttctccggacttgacagccgcttggtgcat
gttgacaacgacggctcgctgcgggactactcctatccgctgtgtgggctcacaggaatc
gaccgctcgcggttcggcatcgaaacgggttcgacgacgtggttcagcgccgacgctgac
cagcggtatcgcggtgacgccggcgtcgtcgagacgatccacgactgcggcgactgggcc
gttgtccagacggactgcaccatcgagcaggcccacgtcacccggttcgaacttcgcggc
gacgcgcccgccgacgtatcgcttcgggcgttcgtcgatttcgcaccagacggacggacc
ggccagcagagcctgctgatgcacggaaactccgtcgaggcctaccaccggtccgaacac
gacttcattggcgtctctaccgaactcgacactgttgcgggccagattcccgagcggttc
tccgaactcgtcgacgacgacccggtctcgttccctcgggacaccggtgcgcgccggtac
gaggacacgacgctaactggcggcgtcctgctgtccgcgccgttcgtcgacggtggcgtc
acgctgacgacgctgctgacggacgcgaacgacaccgaccgcgatacggcgctgtcgacc
atcgaccggctggtgagcgaccactacacttcggagacactgctcgaagcaggccaggca
cagcggcgatggaccgtgcccgcagagacgccgaaccgggagagcgtcgtcgccgacctc
cgggtcctctcgctgctttcggccgcgaacggggccagaatcgccgcgccggacttcgac
ccgtactacgtcacctccggcggctacggctacacgtggttccgcgacgacgccgagata
tcggccttcctgctcgaagccgacgggacgttcgaccttggactcgattcgtggcaccag
cgctccgccgaattctactgtcgcacgcagcaaccggacgggagctggccccaccgtgtc
tggcccggcgacgagacgctcgcgccaggctgggcgaacgcccggctcgaaagcggttct
gacgccgactaccaggccgaccagaccgcgagcgtcaccagcttcctcgcgacgtatctc
cggaccggcgagccggccgacccggagtgcatcgaagccacgctcgggcgcgccgtcgag
agcatcgacgacacgctggccgacgacggcctccccattgcctgccagaacgcctgggag
aacatgcagggtcggttcacgcacaccgctgcgaccttcctgcacgcctacgcggccgtt
gcccgcgcgcccgtctgcgccacgctccgagaccacgcccggtcgcaggccgagacggtg
ttgtcttcgctggacgcgctgtggaccggtgaccgctacgcccttcgtgaacacgatggg
accatcgacaaccgactggactccgcgacgctggccctccccgctgcctgtcgcgtcgct
gccgaagctatcgacctgccagcggagacccgcgaccggctctacacccacgtcgagacg
acacttgacgggctggaacgggacaccggcgacatccgtggtctcatccgcttcgagggc
gacgactggcggcgtggctcgcaagaccgcgagaaaatctggaccgtctcgacggcgtgg
ggcgcaaacagtgccgcccagctgggtgccctcctgcgtgacgccgacgacagcagagcg
gcggcggcctacacccggtcccgggacctgctgggggagattcttcccggcggctcactc
gtccagtccagcggctacctccccgagcaactgttcgacgacgggacgccggactgtggc
acaccgctcggctggccccacgcactccggctggccactgtggcccacctcgatgacgcc
ggggaactcactgctgagccgctgagcgtccgcgaataa

DBGET integrated database retrieval system