KEGG   Haloarcula marismortui: rrnAC2353Help
Entry
rrnAC2353         CDS       T00211                                 

Gene name
cga-2
Definition
glucan 14-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
hma  Haloarcula marismortui
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    rrnAC2353 (cga-2)
Enzymes [BR:hma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     rrnAC2353 (cga-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2095847..2097865)
Genome map
AA seq 672 aa AA seqDB search
MTLRTALNDFKRTRDRRHQFPGELRSTTGSFSGLDSRLVHVDNDGSLRDYSYPLCGLTGI
DRSRFGIETGSTTWFSADADQRYRGDAGVVETIHDCGDWAVVQTDCTIEQAHVTRFELRG
DAPADVSLRAFVDFAPDGRTGQQSLLMHGNSVEAYHRSEHDFIGVSTELDTVAGQIPERF
SELVDDDPVSFPRDTGARRYEDTTLTGGVLLSAPFVDGGVTLTTLLTDANDTDRDTALST
IDRLVSDHYTSETLLEAGQAQRRWTVPAETPNRESVVADLRVLSLLSAANGARIAAPDFD
PYYVTSGGYGYTWFRDDAEISAFLLEADGTFDLGLDSWHQRSAEFYCRTQQPDGSWPHRV
WPGDETLAPGWANARLESGSDADYQADQTASVTSFLATYLRTGEPADPECIEATLGRAVE
SIDDTLADDGLPIACQNAWENMQGRFTHTAATFLHAYAAVARAPVCATLRDHARSQAETV
LSSLDALWTGDRYALREHDGTIDNRLDSATLALPAACRVAAEAIDLPAETRDRLYTHVET
TLDGLERDTGDIRGLIRFEGDDWRRGSQDREKIWTVSTAWGANSAAQLGALLRDADDSRA
AAAYTRSRDLLGEILPGGSLVQSSGYLPEQLFDDGTPDCGTPLGWPHALRLATVAHLDDA
GELTAEPLSVRE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccggacggcactcaacgacttcaagcggacgcgggaccgccgccaccagttc
ccgggtgaactccgctctacgacgggcagtttctccggacttgacagccgcttggtgcat
gttgacaacgacggctcgctgcgggactactcctatccgctgtgtgggctcacaggaatc
gaccgctcgcggttcggcatcgaaacgggttcgacgacgtggttcagcgccgacgctgac
cagcggtatcgcggtgacgccggcgtcgtcgagacgatccacgactgcggcgactgggcc
gttgtccagacggactgcaccatcgagcaggcccacgtcacccggttcgaacttcgcggc
gacgcgcccgccgacgtatcgcttcgggcgttcgtcgatttcgcaccagacggacggacc
ggccagcagagcctgctgatgcacggaaactccgtcgaggcctaccaccggtccgaacac
gacttcattggcgtctctaccgaactcgacactgttgcgggccagattcccgagcggttc
tccgaactcgtcgacgacgacccggtctcgttccctcgggacaccggtgcgcgccggtac
gaggacacgacgctaactggcggcgtcctgctgtccgcgccgttcgtcgacggtggcgtc
acgctgacgacgctgctgacggacgcgaacgacaccgaccgcgatacggcgctgtcgacc
atcgaccggctggtgagcgaccactacacttcggagacactgctcgaagcaggccaggca
cagcggcgatggaccgtgcccgcagagacgccgaaccgggagagcgtcgtcgccgacctc
cgggtcctctcgctgctttcggccgcgaacggggccagaatcgccgcgccggacttcgac
ccgtactacgtcacctccggcggctacggctacacgtggttccgcgacgacgccgagata
tcggccttcctgctcgaagccgacgggacgttcgaccttggactcgattcgtggcaccag
cgctccgccgaattctactgtcgcacgcagcaaccggacgggagctggccccaccgtgtc
tggcccggcgacgagacgctcgcgccaggctgggcgaacgcccggctcgaaagcggttct
gacgccgactaccaggccgaccagaccgcgagcgtcaccagcttcctcgcgacgtatctc
cggaccggcgagccggccgacccggagtgcatcgaagccacgctcgggcgcgccgtcgag
agcatcgacgacacgctggccgacgacggcctccccattgcctgccagaacgcctgggag
aacatgcagggtcggttcacgcacaccgctgcgaccttcctgcacgcctacgcggccgtt
gcccgcgcgcccgtctgcgccacgctccgagaccacgcccggtcgcaggccgagacggtg
ttgtcttcgctggacgcgctgtggaccggtgaccgctacgcccttcgtgaacacgatggg
accatcgacaaccgactggactccgcgacgctggccctccccgctgcctgtcgcgtcgct
gccgaagctatcgacctgccagcggagacccgcgaccggctctacacccacgtcgagacg
acacttgacgggctggaacgggacaccggcgacatccgtggtctcatccgcttcgagggc
gacgactggcggcgtggctcgcaagaccgcgagaaaatctggaccgtctcgacggcgtgg
ggcgcaaacagtgccgcccagctgggtgccctcctgcgtgacgccgacgacagcagagcg
gcggcggcctacacccggtcccgggacctgctgggggagattcttcccggcggctcactc
gtccagtccagcggctacctccccgagcaactgttcgacgacgggacgccggactgtggc
acaccgctcggctggccccacgcactccggctggccactgtggcccacctcgatgacgcc
ggggaactcactgctgagccgctgagcgtccgcgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system